Property Summary

NCBI Gene PubMed Count 52
PubMed Score 3.75
PubTator Score 8.78

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.100 2.4e-03
atypical teratoid / rhabdoid tumor 1.300 4.6e-04
diabetes mellitus -1.300 1.5e-03
ependymoma 1.200 1.8e-03
glioblastoma 1.300 3.6e-04
oligodendroglioma 1.200 1.5e-03
osteosarcoma 1.191 2.4e-03
ovarian cancer -3.200 7.0e-06
Pick disease -1.100 7.5e-04
Polycystic ovary syndrome -1.041 6.4e-03
Rheumatoid arthritis -1.200 2.3e-02
subependymal giant cell astrocytoma -1.799 5.9e-03

Protein-protein Interaction (5)

Gene RIF (24)

AA Sequence

MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGH      1 - 70
DIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDLASRNPTFMCLALHCIANVGS     71 - 140
REMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASPDLVPMGEWTARVVHLLNDQHMGVVTAAVSL    141 - 210
ITCLCKKNPDDFKTCVSLAVSRLSRIVSSASTDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDAAVKGRL    211 - 280
VECLETVLNKAQEPPKSKKVQHSNAKNAILFETISLIIHYDSEPNLLVRACNQLGQFLQHRETNLRYLAL    281 - 350
ESMCTLASSEFSHEAVKTHIDTVINALKTERDVSVRQRAADLLYAMCDRSNAKQIVSEMLRYLETADYAI    351 - 420
REEIVLKVAILAEKYAVDYSWYVDTILNLIRIAGDYVSEEVWYRVLQIVTNRDDVQGYAAKTVFEALQAP    421 - 490
ACHENMVKVGGYILGEFGNLIAGDPRSSPPVQFSLLHSKFHLCSVATRALLLSTYIKFINLFPETKATIQ    491 - 560
GVLRAGSQLRNADVELQQRAVEYLTLSSVASTDVLATVLEEMPPFPERESSILAKLKRKKGPGAGSALDD    561 - 630
GRRDPSSNDINGGMEPTPSTVSTPSPSADLLGLRAAPPPAAPPASAGAGNLLVDVFDGPAAQPSLGPTPE    631 - 700
EAFLSELEPPAPESPMALLADPAPAADPGPEDIGPPIPEADELLNKFVCKNNGVLFENQLLQIGVKSEFR    701 - 770
QNLGRMYLFYGNKTSVQFQNFSPTVVHPGDLQTQLAVQTKRVAAQVDGGAQVQQVLNIECLRDFLTPPLL    771 - 840
SVRFRYGGAPQALTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPQQEAQKIFKANHPMDAEVTKAKLLG    841 - 910
FGSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNAQAQMYRLTLRTSKEPVSRHLCELLAQQF       911 - 977
//

Text Mined References (63)

PMID Year Title