Property Summary

NCBI Gene PubMed Count 20
PubMed Score 90.95
PubTator Score 18.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 1.700 3.9e-02
astrocytic glioma -1.300 1.3e-02
osteosarcoma 1.180 1.2e-02
intraductal papillary-mucinous carcinoma... 1.200 1.2e-02
Breast cancer 3.000 3.0e-02
ductal carcinoma in situ 1.300 1.8e-03
invasive ductal carcinoma 1.100 1.6e-02
ulcerative colitis -1.400 1.1e-03

Gene RIF (4)

PMID Text
21525240 conclude that a specific fraction of the AP2-derived endocytic pathway is dedicated to secretory purposes under the control of AP1 and Gadkin
20332099 Observational study of gene-disease association. (HuGE Navigator)
19965873 Studies unravel the molecular basis for Gadkin-mediated AP-1 recruitment to TGN/endosomal membranes and identify a novel subtype of the AP-1-binding motif.
19706427 Gadkin (gamma-BAR), a peripheral membrane protein localized to the trans-Golgi network and to endosomal vesicles, directly associates with the clathrin adaptor AP-1 and the motor protein kinesin KIF5, potentially regulating endosomal vesicle dynamics.

AA Sequence

MGNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIV      1 - 70
DLRERHYDSIAEKQKDLDKKIQKELALQEEKLRLEEEALYAAQREAARAAKQRKLLEQERQRIVQQYHPS     71 - 140
NNGEYQSSGPEDDFESCLRNMKSQYEVFRSSRLSSDATVLTPNTESSCDLMTKTKSTSGNDDSTSLDLEW    141 - 210
EDEEGMNRMLPMRERSKTEEDILRAALKYSNKKTGSNPTSASDDSNGLEWENDFVSAEMDDNGNSEYSGF    211 - 280
VNPVLELSDSGIRHSDTDQQTR                                                    281 - 302
//

Text Mined References (24)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22689987 2012 Gadkin negatively regulates cell spreading and motility via sequestration of the actin-nucleating ARP2/3 complex.
21525240 2011 Role of AP1 and Gadkin in the traffic of secretory endo-lysosomes.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
19965873 2010 A novel subtype of AP-1-binding motif within the palmitoylated trans-Golgi network/endosomal accessory protein Gadkin/gamma-BAR.
19706427 2009 Regulation of endosomal membrane traffic by a Gadkin/AP-1/kinesin KIF5 complex.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15775984 2005 Gamma-BAR, a novel AP-1-interacting protein involved in post-Golgi trafficking.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.