Property Summary

NCBI Gene PubMed Count 20
PubMed Score 96.28
PubTator Score 18.39

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.300 1.3e-02
Breast cancer 3.000 3.0e-02
ductal carcinoma in situ 1.300 1.8e-03
intraductal papillary-mucinous carcinoma... 1.200 1.2e-02
invasive ductal carcinoma 1.100 1.6e-02
osteosarcoma 1.180 1.2e-02
Rheumatoid arthritis 1.700 3.9e-02
ulcerative colitis -1.100 2.7e-04

Gene RIF (4)

AA Sequence

MGNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIV      1 - 70
DLRERHYDSIAEKQKDLDKKIQKELALQEEKLRLEEEALYAAQREAARAAKQRKLLEQERQRIVQQYHPS     71 - 140
NNGEYQSSGPEDDFESCLRNMKSQYEVFRSSRLSSDATVLTPNTESSCDLMTKTKSTSGNDDSTSLDLEW    141 - 210
EDEEGMNRMLPMRERSKTEEDILRAALKYSNKKTGSNPTSASDDSNGLEWENDFVSAEMDDNGNSEYSGF    211 - 280
VNPVLELSDSGIRHSDTDQQTR                                                    281 - 302
//

Text Mined References (24)

PMID Year Title