Property Summary

NCBI Gene PubMed Count 75
PubMed Score 649.06
PubTator Score 216.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Protein-protein Interaction (6)

Gene RIF (61)

PMID Text
26845338 serum VAP-1 can predict ESRD and is a useful biomarker to improve risk stratification in type 2 diabetic subjects.
26287391 In this article, we will review the general characteristics and biological functions of VAP-1, focusing on its important role as a prognostic biomarker in human pathologies. [review]
25562318 these results link the amine oxidase activity of VAP-1 with hepatic inflammation and fibrosis and suggest that targeting VAP-1 has therapeutic potential for NAFLD and other chronic fibrotic liver diseases.
25457560 It stimulates amyloid beta proteins on the vascular walls, and is contributing to cerebral amyloid angiopathies and Alzheimer disease.
25420878 Complexes of human ORP2 and VAPs at endoplasmic reticulum-lipid droplet interfaces regulate the hydrolysis of triglycerides and lipid droplet turnover.
25342050 the semicarbazide-sensitive amine oxidase activity of VAP-1 modifies hepatic glucose homeostasis and may contribute to patterns of GLUT expression in chronic disease.
24903765 This study demonstrated that low serum VAP-1 levels are associated with poor prognosis in gastric cancer patients.
24781952 Higher serum VAP-1 and Chronic kidney disease can independently predict future development of cancers in type II diabetic subjects
24503888 SSAO expression in endothelial cells increases oxygen-glucose-deprivation-associated cell damage. It mediates some tissue damage during the reoxygenation process by oxidizing its known enzymatic substrate, methylamine.
24379274 We concluded that VAP-1, elevated in patients on Peritoneal Dialysis, was predominantly dependent on residual kidney function and glucose level, factors both linked to endothelial damage and cardiovascular complications.
24211727 Serum VAP-1 predicts mortality independently and improves risk stratification in colorectal cancer subjects.
23769096 VAP-1 elevations in heart transplant recipients were predominantly dependent on left ventricular diameter and use of tacrolimus
23349812 Data suggest that the down-regulation of both the expression and enzymatic activity of VAP-1 may result from a dominant-negative effect caused by heterodimerization between VAP-1 and alternatively spliced VAP-1Delta3.
23120772 The pathogenetic link between the increase in SSAO activity and severity of neurological deficitin ischemic stroke patients was shown.
23062326 Data suggest that subjects with diabetic retinopathy have higher serum levels of soluble VAP1 than subjects with non-angiogenic ocular diseases (i.e., epiretinal membrane [ERM], idiopathic macular hole [MH], age-related macular degeneration [AMD]).
22753196 In psoriatic patients, VAP-1 elevation correlated with elevation of Lp (a). This may be responsible for a higher prevalence of cardiovascular accidents in psoriatic patients.
22714978 high vascular SSAO/VAP-1 levels in human hippocampus may contribute to vascular degeneration
22618595 Protein level of sVAP-1 was increased and correlated with HEL in the vitreous fluid of patients with PDR.
22354146 The immunolocalization of VAP-1 varied in the histopathology of the conjunctiva, involving the pathology of inflammatory conjunctival disorders.
22150439 We found increased VAP-1 activity and anchor protein syndecan-1 content in critically ill patients with septic shock
22133888 Plasma VAP-1/SSAO activity is increased in intracranial hemorrhage and predicts neurological outcome, suggesting a possible contribution of the soluble protein in secondary brain damage.
21821708 The Siglec-9 peptide binding to the enzymatic groove of VAP-1 can be used for imaging conditions, such as inflammation and cancer.
21819380 using an endothelial cell model, a description for the first time the involvement of the leucocyte-adhesion activity of SSAO/VAP-1 in the Abeta (amyloid beta-peptide)-mediated pro-inflammatory effect
21585208 Met211 and Leu469 were shown to be key residues for substrate specificity.
21512782 This review examines the biological functions of VAP-1, especially the role that this molecule might play in the establishment and progression of chronic liver disease.
21282368 Serum VAP-1 can predict 10-year all-cause mortality, cardiovascular mortality, and cancer mortality independently in type 2 diabetic subjects.
21139198 The structure of VAP-1 was refined to a resolution of 2.9A.
21114364 These remarks suggest that MAO-A and SSAO may play an important role in vascular tissue as well as in the vascular pathophysiology of type 2 diabetes.
20512991 A novel combination of surface molecules, including VAP-1 and CX(3)CL1 promotes the recruitment of CD16(+) monocytes to the liver, allowing them to localize at sites of chronic inflammation and fibrosis.
20063021 The SSAO activity in the serum of patients with type 2 diabetes is higher when compared with control group and may be a useful marker for diabetes.
19861682 the Siglec-10-VAP-1 interaction seems to mediate lymphocyte adhesion to endothelium
19789505 Inflammation of the dental pulp was accompanied by a significant decrease in MAO labeling, MAO B (but not MAO A) activity and the increase in SSAO activity.
19761765 immunohistochemistry reveals constitutive expression of VAP-1 in human ocular tissues.
19361461 acute change of serum SSAO/VAP-1 is a novel marker for hyperglycemia-induced atherosclerosis
19336232 Serum VAP-1 is increased in both acute and chronic hyperglycemia.
18991279 VAP-1 regulates the inflammatory response in ischemia-reperfusion injury and suggest that blockade of VAP-1 may have therapeutic value.
18853098 Increase in the SSAO activity and nitrite and nitrite levels observed in type 2 diabetic patients could be parameters to take in account and play relevant role in diabetes development.
18644360 Serum levels of VAP-1 are associated with the severity of kidney damage or stages of kidney disease.
18005095 VAP-1 may aggravate ischaemic vascular changes and thhe subsequent release of VAP-1 into circulation could be further examined as a potential marker of early ischaemic vasculopathy.
17490641 Data suggest atherosclerotic inflammation may be a trigger for sclerosis in calcified stenotic aortic valves through upregulation TGF-beta, VAP-1, MIG and Eotaxin3, which is only partially inhibited by previous statin therapy.
17431736 The elevated serum SSAO activity measured through the detection of the enzyme-generated hydrogen peroxide in HD patients might indicate its contribution to the accelerated atherosclerotic disease observed in uremia.
17400359 semicarbazide-sensitive amine oxidase expression during in vitro differentiation of human preadipocytes and in adipose and stroma-vascular fractions of human fat depots
17393062 VAP-1 was located solely in the membrane fraction of the vascular smooth muscle cell. However it was also shown to be released into the cell-culture medium.
17393059 Taken together, these results allow us to postulate that SSAO may contribute to the vascular damage associated to AD.
17256751 We propose that as well as directly promoting adhesion via interactions with the as yet unknown ligand, binding of enzyme substrate to VAP-1 can indirectly promote inflammatory cell recruitment via upregulation of adhesion molecules and chemokines.
17006978 Expression of VAP-1, Stabilin-1, L-SIGN can be used to identify sinusoidal endothelium and to permit discrimination from vascular and lymphatic endothelial cells.
16806498 We propose that VAP-1 might participate in controlling leukocyte entry into inflamed brain.
16556889 VAP-1 may contribute critically to the oxidase activities in utero, and prove important for lymphocyte trafficking during human ontogeny.
16511016 Tetragonal crystals were obtained and a data set extending to 2.5 A was collected. The crystals are merohedrally twinned and the estimate of the twinning fraction was complicated by pseudo-symmetry of the crystals.
16507887 A role for AOC3-mediated deamination in pulmonary inflammation was shown.
16361866 This study indicates the important role of VAP-1 in the pathogenesis of chronic inflammatory cutaneous disorders, including AE.
16046623 The dimer structure reveals intriguing features that may have fundamental roles in the adhesive and enzymatic functions of hVAP-1.
15919838 results suggest that vascular adhesion protein-1 (VAP-1) levels are correlated with fasting glucose and insulin in morbidly obese subjects, and after surgery VAP-1 levels were associated with changes in visceral adiposity and diastolic blood pressure
15830186 Plasma semicarbazide-sensitive amine oxidase (SSAO) is elevated in patients with type 1 and type 2 diabetes and has been implicated in the pathophysiology of diabetic late complications.
15057044 VAP-1 protein expression is significantly decreased in intratumoral vessels compared with peritumoral ones; this difference was independent of the skin melanoma thickness
14755492 Semicarbazide-sensitive amine oxidase is a source of oxidative stress in diseased human skeletal muscle; it contributes to oxidative stress-induced damage in various inflammatory and other myopathies.
14726375 the oxidase activity of VAP-1 controls PMN exit from the blood during the relatively poorly understood transmigration step
14715500 may convert endogenous amines, like methylamine, to vasoactive metabolites.
12700900 normal mice and human lungs revealed vascular adhesion protein-1 expression in the endothelium of large and mid-sized pulmonary vessels
12466139 Data show that increases in vascular adhesion protein-1 (VAP-1) due to absolute or relative insulin deficiency may be directly involved in the pathogenesis of diabetic angiopathy.
12097405 VAP-1 is expressed on hepatic sinusoidal endothelial cells in vitro and supports adhesion and transmigration of lymphocytes across these cells under physiological shear stress.

AA Sequence

MNQKTILVLLILAVITIFALVCVLLVGRGGDGGEPSQLPHCPSVSPSAQPWTHPGQSQLFADLSREELTA      1 - 70
VMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAAALAHLDRGSPPPAREALAIVFFGRQPQPNVSE     71 - 140
LVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDIDQMIFNRELPQASGLLHHCCFYKHRGRNLVT    141 - 210
MTTAPRGLQSGDRATWFGLYYNISGAGFFLHHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQ    211 - 280
FEAGLVNVVLIPDNGTGGSWSLKSPVPPGPAPPLQFYPQGPRFSVQGSRVASSLWTFSFGLGAFSGPRIF    281 - 350
DVRFQGERLVYEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQ    351 - 420
APKTIRDAFCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFHPSGAIEIRFY    421 - 490
ATGYISSAFLFGATGKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVWAEDMVFVPMAVPWSPEHQLQ    491 - 560
RLQVTRKLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHPRGYRIQMLSFAGEPLPQNSSMARGFSWERY    561 - 630
QLAVTQRKEEEPSSSSVFNQNDPWAPTVDFSDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNG    631 - 700
VGFFLRPYNFFDEDPSFYSADSIYFRGDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSHN           701 - 763
//

Text Mined References (80)

PMID Year Title
26845338 2016 Serum Vascular Adhesion Protein-1 Predicts End-Stage Renal Disease in Patients with Type 2 Diabetes.
26287391 2015 Vascular adhesion protein-1: Role in human pathology and application as a biomarker.
25562318 2015 Vascular adhesion protein-1 promotes liver inflammation and drives hepatic fibrosis.
25457560 2015 Cross-talk between A? and endothelial SSAO/VAP-1 accelerates vascular damage and A? aggregation related to CAA-AD.
25420878 2015 Ligand-dependent localization and function of ORP-VAP complexes at membrane contact sites.
25342050 2014 Dysregulated hepatic expression of glucose transporters in chronic disease: contribution of semicarbazide-sensitive amine oxidase to hepatic glucose uptake.
24903765 2014 Relationship between serum soluble vascular adhesion protein-1 level and gastric cancer prognosis.
24781952 2014 Serum vascular adhesion protein-1 level predicts risk of incident cancers in subjects with type II diabetes.
24503888 2014 Involvement of SSAO/VAP-1 in oxygen-glucose deprivation-mediated damage using the endothelial hSSAO/VAP-1-expressing cells as experimental model of cerebral ischemia.
24379274 2013 VAP-1 in peritoneally dialyzed patients.
24211727 2014 Serum vascular adhesion protein-1 predicts all-cause mortality and cancer-related mortality in subjects with colorectal cancer.
23769096 2013 Vascular adhesion protein-1, a novel molecule, in kidney and heart allograft recipients.
23474851 2013 Cellular localization and trafficking of vascular adhesion protein-1 as revealed by an N-terminal GFP fusion protein.
23349812 2013 Functional modulation of vascular adhesion protein-1 by a novel splice variant.
23120772 2011 [Role of semicarbazide-sensitive amine oxidase in disturbances of endogenic detoxication in ischemic stroke patients].
23062326 Serum vascular adhesion protein-1 correlates with vascular endothelial growth factor in patients with type II diabetes.
22753196 2013 Serum lipid profile in psoriatic patients: correlation between vascular adhesion protein 1 and lipoprotein (a).
22714978 2012 Immunohistochemical study of semicarbazide-sensitive amine oxidase/vascular adhesion protein-1 in the hippocampal vasculature: pathological synergy of Alzheimer's disease and diabetes mellitus.
22618595 2012 Soluble vascular adhesion protein-1 accumulates in proliferative diabetic retinopathy.
22354146 2012 Immunolocalization of vascular adhesion protein-1 in human conjunctival tumors.
22150439 2012 Vascular adhesion protein-1 and syndecan-1 in septic shock.
22133888 2012 VAP-1/SSAO plasma activity and brain expression in human hemorrhagic stroke.
21821708 2011 Siglec-9 is a novel leukocyte ligand for vascular adhesion protein-1 and can be used in PET imaging of inflammation and cancer.
21819380 2011 Vascular cell lines expressing SSAO/VAP-1: a new experimental tool to study its involvement in vascular diseases.
21585208 2011 Identification of two imidazole binding sites and key residues for substrate specificity in human primary amine oxidase AOC3.
21512782 2011 Hepatic consequences of vascular adhesion protein-1 expression.
21282368 2011 Serum vascular adhesion protein-1 predicts 10-year cardiovascular and cancer mortality in individuals with type 2 diabetes.
21139198 2010 A new crystal form of human vascular adhesion protein 1.
21114364 2011 Monoamine oxidase and semicarbazide-sensitive amine oxidase kinetic analysis in mesenteric arteries of patients with type 2 diabetes.
20512991 2010 CX(3)CR1 and vascular adhesion protein-1-dependent recruitment of CD16(+) monocytes across human liver sinusoidal endothelium.
20063021 2010 Changes in the activities of semicarbazide-sensitive amine oxidase in inferior mesenteric artery segments and in serum of patients with type 2 diabetes.
19861682 2009 Human Siglec-10 can bind to vascular adhesion protein-1 and serves as its substrate.
19789505 2009 Monoamine oxidase and semicarbazide sensitive amine oxidase activities in normal and inflamed human dental pulp.
19764817 2009 Structure and inhibition of human diamine oxidase.
19761765 2010 Localization of vascular adhesion protein-1 (VAP-1) in the human eye.
19588076 2009 The unique substrate specificity of human AOC2, a semicarbazide-sensitive amine oxidase.
19361461 2009 Change of serum vascular adhesion protein-1 after glucose loading correlates to carotid intima-medial thickness in non-diabetic subjects.
19336232 2009 Serum vascular adhesion protein-1 is increased in acute and chronic hyperglycemia.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18991279 2008 Ischemia-reperfusion injury is attenuated in VAP-1-deficient mice and by VAP-1 inhibitors.
18853098 2009 Semicarbazide-sensitive amine oxidase activity and total nitrite and nitrate concentrations in serum: novel biochemical markers for type 2 diabetes?
18644360 2008 Serum vascular adhesion protein-1 is higher in subjects with early stages of chronic kidney disease.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18005095 2008 Vascular adhesion protein-1 in human ischaemic stroke.
17490641 2007 VAP-1, Eotaxin3 and MIG as potential atherosclerotic triggers of severe calcified and stenotic human aortic valves: effects of statins.
17431736 2007 Alteration of serum semicarbazide-sensitive amine oxidase activity in chronic renal failure.
17400359 2007 Adipogenesis-related increase of semicarbazide-sensitive amine oxidase and monoamine oxidase in human adipocytes.
17393062 2007 Characterization of A7r5 cell line transfected in a stable form by hSSAO/VAP-1 gene (A7r5 hSSAO/VAP-1 cell line).
17393059 2007 Semicarbazide-sensitive amine oxidase (SSAO) and its possible contribution to vascular damage in Alzheimer's disease.
17256751 2007 Activation of vascular adhesion protein-1 on liver endothelium results in an NF-kappaB-dependent increase in lymphocyte adhesion.
17006978 2006 Human hepatic sinusoidal endothelial cells can be distinguished by expression of phenotypic markers related to their specialised functions in vivo.
16806498 2006 Elevated serum soluble vascular adhesion protein-1 (VAP-1) in patients with active relapsing remitting multiple sclerosis.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16556889 2006 Developmental regulation of the adhesive and enzymatic activity of vascular adhesion protein-1 (VAP-1) in humans.
16511016 2005 Crystallization of a truncated soluble human semicarbazide-sensitive amine oxidase.
16507887 2006 Involvement of semicarbazide-sensitive amine oxidase-mediated deamination in lipopolysaccharide-induced pulmonary inflammation.
16361866 2006 Expression of vascular adhesion protein-1 in atopic eczema.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16046623 2005 Crystal structure of the human vascular adhesion protein-1: unique structural features with functional implications.
15919838 2005 Change in vascular adhesion protein-1 and metabolic phenotypes after vertical banded gastroplasty for morbid obesity.
15830186 2005 Association between plasma activities of semicarbazide-sensitive amine oxidase and angiotensin-converting enzyme in patients with type 1 diabetes mellitus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15242332 2004 Vectorial proteomics reveal targeting, phosphorylation and specific fragmentation of polymerase I and transcript release factor (PTRF) at the surface of caveolae in human adipocytes.
15057044 2004 Loss of vascular adhesion protein-1 expression in intratumoral microvessels of human skin melanoma.
14755492 2004 Overexpression of semicarbazide-sensitive amine oxidase in human myopathies.
14726375 2004 Granulocyte transmigration through the endothelium is regulated by the oxidase activity of vascular adhesion protein-1 (VAP-1).
14715500 2004 Vasoactive effects of methylamine in isolated human blood vessels: role of semicarbazide-sensitive amine oxidase, formaldehyde, and hydrogen peroxide.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14585497 2003 Characterization of AOC2 gene encoding a copper-binding amine oxidase expressed specifically in retina.
12700900 2003 Expression of vascular adhesion protein-1 in normal and inflamed mice lungs and normal human lungs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466139 2002 Insulin-regulated increase of soluble vascular adhesion protein-1 in diabetes.
12097405 2002 Vascular adhesion protein-1 mediates adhesion and transmigration of lymphocytes on human hepatic endothelial cells.
9653080 1998 Cloning of vascular adhesion protein 1 reveals a novel multifunctional adhesion molecule.
9110174 1997 Large-scale concatenation cDNA sequencing.
8972912 1996 Cloning and sequencing of a copper-containing, topa quinone-containing monoamine oxidase from human placenta.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
1375396 1992 Tyrosine phosphorylation of the vav proto-oncogene product in activated B cells.