Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.98
PubTator Score 11.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.5e-09
Disease Target Count Z-score Confidence
Adenosquamous carcinoma 2 3.667 1.8

Gene RIF (1)

PMID Text
18223320 Claudin 18 and annexin A8 are frequently highly overexpressed in infiltrating ductal adenocarcinomas.

AA Sequence

MAWWKSWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKD      1 - 70
LTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYG     71 - 140
SSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPGLALQDAQDLYAAGEKIRGTDEMKFITILCTRSA    141 - 210
THLLRVFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNI    211 - 280
VSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP                           281 - 327
//

Text Mined References (17)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
18223320 2008 New markers of pancreatic cancer identified through differential gene expression analyses: claudin 18 and annexin A8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15928709 2005 Annexins: linking Ca2+ signalling to membrane dynamics.
15644210 2005 The crystal structure of annexin A8 is similar to that of annexin A3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11917092 2002 Annexins: from structure to function.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8045287 1994 Differential tissue expression of Annexin VIII in human.
8018923 1994 Regulation of the expression of annexin VIII in acute promyelocytic leukemia.
2530088 1989 Vascular anticoagulant beta: a novel human Ca2+/phospholipid binding protein that inhibits coagulation and phospholipase A2 activity. Its molecular cloning, expression and comparison with VAC-alpha.
1364010 1992 TaqI polymorphisms at the annexin VIII locus (ANX8).
1313714 1992 Specific expression of the annexin VIII gene in acute promyelocytic leukemia.