Property Summary

NCBI Gene PubMed Count 69
PubMed Score 293.36
PubTator Score 209.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -1.100 2.1e-03
osteosarcoma -1.496 1.9e-04
periodontitis 1.100 9.1e-31
primitive neuroectodermal tumor -1.400 8.7e-03
tuberculosis 2.100 2.3e-08
primary pancreatic ductal adenocarcinoma 1.136 1.9e-03
intraductal papillary-mucinous carcinoma... -1.200 5.4e-03
intraductal papillary-mucinous neoplasm ... -1.600 8.3e-04
lung cancer -1.500 5.3e-05
cystic fibrosis 1.400 3.0e-03
group 4 medulloblastoma -1.300 7.8e-03
ulcerative colitis 1.600 1.2e-03
ovarian cancer 1.500 7.4e-04
dermatomyositis -1.200 4.8e-04

Protein-protein Interaction (3)

Gene RIF (37)

PMID Text
26578516 Data suggest that reduced ability of AnxA6-expressing cells to migrate is associated with decreased cell surface expression of integrins alphaVbeta3 and alpha5beta1.
26202167 ANXA6 was detected as a novel systemic lupus erythematosus susceptibility gene, with several single-nucleotide polymorphisms (SNPs) contributing independently to the association with disease
25947258 ANXA6 is a EZH2 target gene involving gastric cellular proliferation.
25409976 Evidence for annexin A6-dependent plasma membrane remodelling of lipid domains
24354805 The rapid degradation of activated EGFR in AnxA6-depleted invasive tumor cells underlies their sensitivity to EGFR-targeted inhibitors.
24194536 These results show that influenza A virus replication depends on maintenance of the cellular cholesterol balance and identify AnxA6 as a critical factor in linking the virus to cellular cholesterol homeostasis.
23683957 Influence of the 524-VAAEIL-529 sequence of annexins A6 in their interfacial behavior and interaction with lipid monolayers.
23541940 TNIP1/ANXA6 and CSMD1 variants interacting with cigarette smoking and alcohol intake affect risk of psoriasis.
23360953 Ca(2+) is the main factor which regulates the interaction of AnxA6 with monolayers composed of neutral lipids, determine AnxA6 localization in cholesterol and sphingomyelin enriched microdomains, thus contributing to the etiology of the NPC disease.
23341998 anxA6 inhibits Drp1 activity, and Ca(2+)-binding to anxA6 relieves this inhibition to permit Drp1-mediated mitochondrial fission
22797061 AnxA6 is a new PKCalpha scaffold to promote PKCalpha-mediated EGFR inactivation.
22399299 AnxA6 via its stimulatory actions on PKCalpha and its role in mediating Ca(2+) flux across membranes regulates terminal differentiation and mineralization events of chondrocytes.
21990038 the regulation of cell surface receptors by annexin A6 may be facilitated by its unique structure that allows recruitment of interaction partners and simultaneously bridging specialized membrane domains with cortical actin surrounding activated receptors
21672540 AnxA6 is a novel receptor that mediates the endocytosis of bovine beta-glucuronidase.
21216236 In the presence of calcium, AnxA6 re-located to the fractions enriched in detergent-resistant microdomains only in the Niemann-Pick type C disease cells, suggestive of AnxA6 participation in organization of these microdomains.
21185831 reduced AnxA6 expression contributes to breast cancer progression by promoting the loss of functional cell-cell and/or cell-ECM contacts and anchorage-independent cell proliferation
21119665 High ANXA6 expression in the cytoplasm is associated with uterine cervix carcinogenesis.
20888375 In addition to regulating cholesterol and caveolin distribution, AnxA6 acts as a scaffold/targeting protein for several signaling proteins.
20363475 Data suggests that the hydroxyl group of cholesterol and Trp 343 are involved in AnxA6-membrane interactions.
19900398 AnxA6 may participate in formation of cholesterol-rich platforms on LE and therefore may contribute to the pathology of the NPC disease.
19386597 results implicate annexin A6 in the actin-dependent regulation of Ca(2+) entry, with consequences for the rates of cell proliferation
19345290 These findings indicate that the polymorphisms of ANXA6 are associated with osteonecrosis of the femoral head.
19345290 Observational study of gene-disease association. (HuGE Navigator)
19322030 Annexin A6 is highly abundant in monocytes of obese and type 2 diabetic individuals.
18786929 annexin A6 contributes to the calcium-dependent cell surface exposition of the membrane associated-S100A8/A9 complex
18245088 AnxA6 interferes with caveolin transport through the inhibition of cPLA(2).
18164291 analysis of translocation and assembly at the plasma membrane and the nuclear envelope
17824845 analysis of the pH-induced membrane binding of annexins A6 and A2-S100A10
17822395 Annexin A6 has roles in alterations in cholesterol transport and caveolin export from the Golgi complex
16674946 It is a first report supporting the hypothesis of a direct implication of AnxA6 in vitamin A-dependent tissue mineralization.
16153422 Macrophage reprogramming during oxidative stress occurs through the cytosolic mobilization of annexin VI from lipid rafts.
15576473 TPD52 bound to annexin VI in a Ca(2+)-dependent manner suggesting that these molecules may act in concert to regulate secretory processes in plasma cells
15355961 endogenous annexin 6 could regulate the Maxi-chloride channel in placenta
15226301 cell surface annexin VI may function as an acidic pH binding site or receptor and may also function as a co-receptor with LRP-1 at neutral pH
12885247 The nucleotide-binding site of ANXA6 is formed by the amino acid residues located in both halves of the protein, in two distinct domains.
12534274 Characterization of phosphorylation-mimicking mutant annexin VI (T356D) reveals a potential regulatory mechanism leading to a higher degree of flexibility and possibly a higher calcium binding affinity of annexin VI upon phosphorylation.
12140262 Data show that annexin 6 is a candidate receptor for chondroitin sulfate chains.

AA Sequence

MAKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDL      1 - 70
IADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYER     71 - 140
DLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQH    141 - 210
LRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVS    211 - 280
RSELDMLDIREIFRTKYEKSLYSMIKNDTSGEYKKTLLKLSGGDDDAAGQFFPEAAQVAYQMWELSAVAR    281 - 350
VELKGTVRPANDFNPDADAKALRKAMKGLGTDEDTIIDIITHRSNVQRQQIRQTFKSHFGRDLMTDLKSE    351 - 420
ISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKEDYHKSLEDALS    421 - 490
SDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDKTSLETRFMTILCTRSYPHLR    491 - 560
RVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRS    561 - 630
EIDLLNIRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED                               631 - 673
//

Text Mined References (76)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26578516 2016 Annexin A6 and Late Endosomal Cholesterol Modulate Integrin Recycling and Cell Migration.
26202167 2015 Gene-based meta-analysis of genome-wide association study data identifies independent single-nucleotide polymorphisms in ANXA6 as being associated with systemic lupus erythematosus in Asian populations.
25947258 2015 Genome-wide transcriptional profiling analysis reveals annexin A6 as a novel EZH2 target gene involving gastric cellular proliferation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25409976 2015 Evidence for annexin A6-dependent plasma membrane remodelling of lipid domains.
24354805 2013 Reduced annexin A6 expression promotes the degradation of activated epidermal growth factor receptor and sensitizes invasive breast cancer cells to EGFR-targeted tyrosine kinase inhibitors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24194536 2013 Annexin A6-balanced late endosomal cholesterol controls influenza A replication and propagation.
23683957 2013 Influence of the 524-VAAEIL-529 sequence of annexins A6 in their interfacial behavior and interaction with lipid monolayers.
23541940 2013 TNIP1/ANXA6 and CSMD1 variants interacting with cigarette smoking, alcohol intake affect risk of psoriasis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23360953 2013 Interaction of AnxA6 with isolated and artificial lipid microdomains; importance of lipid composition and calcium content.
23341998 2013 Regulation of mitochondrial morphogenesis by annexin A6.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22797061 2013 Annexin A6 is a scaffold for PKC? to promote EGFR inactivation.
22399299 2012 Intracellular modulation of signaling pathways by annexin A6 regulates terminal differentiation of chondrocytes.
21990038 2011 Annexin A6 is an organizer of membrane microdomains to regulate receptor localization and signalling.
21672540 2011 Annexin VI is a mannose-6-phosphate-independent endocytic receptor for bovine ?-glucuronidase.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
21269460 2011 Initial characterization of the human central proteome.
21216236 2011 Annexin A6 is recruited into lipid rafts of Niemann-Pick type C disease fibroblasts in a Ca2+-dependent manner.
21185831 2011 Annexin A6 contributes to the invasiveness of breast carcinoma cells by influencing the organization and localization of functional focal adhesions.
21119665 2011 Differential expression of ANXA6, HSP27, PRDX2, NCF2, and TPM4 during uterine cervix carcinogenesis: diagnostic and prognostic value.
20888375 2011 Annexin A6-Linking Ca(2+) signaling with cholesterol transport.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20363475 2010 Interaction of annexin A6 with cholesterol rich membranes is pH-dependent and mediated by the sterol OH.
19946888 2010 Defining the membrane proteome of NK cells.
19900398 2010 Cholesterol as a factor regulating intracellular localization of annexin A6 in Niemann-Pick type C human skin fibroblasts.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19386597 2009 Plasma membrane-associated annexin A6 reduces Ca2+ entry by stabilizing the cortical actin cytoskeleton.
19345290 2009 Polymorphisms in the Annexin gene family and the risk of osteonecrosis of the femoral head in the Korean population.
19322030 2009 Annexin A6 is highly abundant in monocytes of obese and type 2 diabetic individuals and is downregulated by adiponectin in vitro.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18786929 2008 Interaction between S100A8/A9 and annexin A6 is involved in the calcium-induced cell surface exposition of S100A8/A9.
18245088 2008 Annexin A6-induced inhibition of cytoplasmic phospholipase A2 is linked to caveolin-1 export from the Golgi.
18164291 2008 Heterogeneity and timing of translocation and membrane-mediated assembly of different annexins.
17824845 2008 Annexins sense changes in intracellular pH during hypoxia.
17822395 2007 Annexin A6-induced alterations in cholesterol transport and caveolin export from the Golgi complex.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16674946 2006 A novel retinoid binding property of human annexin A6.
16605264 2006 Effects of mutagenesis of W343 in human annexin A6 isoform 1 on its interaction with GTP: nucleotide-induced oligomer formation and ion channel activity.
16153422 2005 Oxidative-induced calcium mobilization is dependent on annexin VI release from lipid rafts.
15576473 2005 Tumor protein D52 (TPD52): a novel B-cell/plasma-cell molecule with unique expression pattern and Ca(2+)-dependent association with annexin VI.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15355961 2004 Annexin 6 modulates the maxi-chloride channel of the apical membrane of syncytiotrophoblast isolated from human placenta.
15242332 2004 Vectorial proteomics reveal targeting, phosphorylation and specific fragmentation of polymerase I and transcript release factor (PTRF) at the surface of caveolae in human adipocytes.
15226301 2004 Identification and characterization of the acidic pH binding sites for growth regulatory ligands of low density lipoprotein receptor-related protein-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12885247 2003 A putative consensus sequence for the nucleotide-binding site of annexin A6.
12534274 2003 Structural and dynamic changes in human annexin VI induced by a phosphorylation-mimicking mutation, T356D.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12140262 2002 Annexin 6 is a putative cell surface receptor for chondroitin sulfate chains.
11696438 2001 Expression of early and late differentiation markers (proliferating cell nuclear antigen, syndecan-3, annexin VI, and alkaline phosphatase) by human osteoarthritic chondrocytes.
10618640 1999 Differential display of human marrow stromal cells reveals unique mRNA expression patterns in response to dexamethasone.
10571081 1999 Mapping the site of interaction between annexin VI and the p120GAP C2 domain.
9883272 1998 Annexin VI binds S100A1 and S100B and blocks the ability of S100A1 and S100B to inhibit desmin and GFAP assemblies into intermediate filaments.
9515022 1998 Altered cardiac annexin mRNA and protein levels in the left ventricle of patients with end-stage heart failure.
9195978 1997 Novel progesterone target genes identified by an improved differential display technique suggest that progestin-induced growth inhibition of breast cancer cells coincides with enhancement of differentiation.
8834809 1996 Annexins II, IV, V and VI relocate in response to rises in intracellular calcium in human foreskin fibroblasts.
8798684 1996 The Ca2+-dependent lipid binding domain of P120GAP mediates protein-protein interactions with Ca2+-dependent membrane-binding proteins. Evidence for a direct interaction between annexin VI and P120GAP.
8709144 1996 The structure of recombinant human annexin VI in crystals and membrane-bound.
8146179 1994 Structure of the human annexin VI gene.
7698768 1994 High-resolution physical mapping of human 5q31-q33 using three methods: radiation hybrid mapping, interphase fluorescence in situ hybridization, and pulsed-field gel electrophoresis.
3258820 1988 Primary structure of the human, membrane-associated Ca2+-binding protein p68 a novel member of a protein family.
2963335 1988 Human 67-kDa calelectrin contains a duplication of four repeats found in 35-kDa lipocortins.
2731935 1989 The gene coding for the p68 calcium-binding protein is localised to bands q32-q34 of human chromosome 5, and to mouse chromosome 11.
2528541 1989 Structure and expression of cDNA for calphobindin II, a human placental coagulation inhibitor.
2139657 1990 Structure and properties of calphobindin II, an anticoagulant protein from human placenta.
2138016 1990 Characterization of Ca2(+)-dependent phospholipid binding, vesicle aggregation and membrane fusion by annexins.
1831222 1991 Intracellular interaction of EBV/C3d receptor (CR2) with p68, a calcium-binding protein present in normal but not in transformed B lymphocytes.
1420329 1992 A growth-dependent post-translational modification of annexin VI.