Property Summary

NCBI Gene PubMed Count 168
PubMed Score 6864.06
PubTator Score 4068.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 2.0

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease 1.568 4.6e-03
active ulcerative colitis 1.336 1.2e-02
acute quadriplegic myopathy 1.057 4.4e-04
adult high grade glioma 1.500 1.9e-04
astrocytoma 1.100 1.4e-14
Astrocytoma, Pilocytic 1.900 1.7e-10
atypical teratoid / rhabdoid tumor 1.200 1.2e-03
autosomal dominant Emery-Dreifuss muscul... 1.120 9.1e-03
breast carcinoma 1.400 2.9e-02
Down syndrome 1.300 6.8e-04
Duchenne muscular dystrophy 1.435 1.9e-08
ependymoma 1.600 7.8e-13
glioblastoma 1.700 6.7e-09
juvenile dermatomyositis 1.432 1.7e-11
lung cancer -1.100 4.7e-04
lung carcinoma -1.100 2.2e-16
Multiple myeloma 1.821 8.4e-04
osteosarcoma 2.450 1.9e-06
ovarian cancer -3.000 8.4e-10
pancreatic cancer 1.100 3.0e-03
sonic hedgehog group medulloblastoma 1.100 8.8e-04
subependymal giant cell astrocytoma 1.302 1.7e-02
tuberculosis and treatment for 6 months -1.200 2.0e-03

Protein-protein Interaction (1)

PDB (12)

Gene RIF (130)

AA Sequence

MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLK      1 - 70
SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDD     71 - 140
VVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVF    141 - 210
DKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEID    211 - 280
LFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD                                  281 - 320
//

Text Mined References (180)

PMID Year Title