Property Summary

NCBI Gene PubMed Count 66
PubMed Score 153.61
PubTator Score 108.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 1.549 2.3e-08
atypical teratoid / rhabdoid tumor 1.100 3.6e-02
autosomal dominant Emery-Dreifuss muscul... 1.014 1.0e-02
Barrett's esophagus 1.200 2.3e-02
Breast cancer 3.100 3.0e-02
Chronic Lymphocytic Leukemia -1.583 3.1e-03
dermatomyositis 1.300 6.8e-03
Duchenne muscular dystrophy 1.181 3.5e-06
ependymoma 1.800 3.4e-12
esophageal adenocarcinoma 1.700 1.8e-02
glioblastoma 1.500 2.2e-03
juvenile dermatomyositis 1.172 6.3e-12
lung cancer -1.500 3.0e-03
lung carcinoma -2.000 3.4e-36
malignant mesothelioma -3.100 3.0e-09
non-small cell lung cancer -1.157 1.2e-17
ovarian cancer -2.700 1.3e-07
psoriasis 1.300 1.8e-04
tuberculosis 3.200 9.9e-10

Gene RIF (31)

AA Sequence

MATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKS      1 - 70
ELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDI     71 - 140
RSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFD    141 - 210
EYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDM    211 - 280
LDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD                                   281 - 319
//

Text Mined References (72)

PMID Year Title