Property Summary

NCBI Gene PubMed Count 53
PubMed Score 104.57
PubTator Score 97.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
ovarian neoplasm 99
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 0.0244697740795451
Disease Target Count Z-score Confidence
Cancer 2499 3.388 1.7

Expression

  Differential Expression (30)

Disease log2 FC p
Rheumatoid arthritis 1.800 2.4e-02
active Crohn's disease 1.712 8.6e-03
active ulcerative colitis 2.119 4.6e-03
adult high grade glioma -2.800 4.7e-07
astrocytic glioma -2.100 4.1e-02
Astrocytoma, Pilocytic -2.700 1.0e-09
atypical teratoid/rhabdoid tumor -1.400 1.4e-02
Breast cancer -2.700 3.2e-07
breast carcinoma -1.400 7.8e-16
colon cancer 2.100 3.0e-02
cystic fibrosis 1.423 2.8e-05
ependymoma -2.300 1.7e-09
gastric cancer 2.200 4.1e-03
glioblastoma -2.400 1.0e-07
group 3 medulloblastoma -2.300 1.1e-04
intraductal papillary-mucinous adenoma (... 2.500 1.5e-03
intraductal papillary-mucinous carcinoma... 1.700 2.8e-02
intraductal papillary-mucinous neoplasm ... 2.800 1.0e-02
lung adenocarcinoma -1.300 1.5e-08
lung cancer -4.100 8.7e-07
lung carcinoma -4.200 2.2e-36
malignant mesothelioma -1.200 2.2e-06
medulloblastoma, large-cell -3.300 2.8e-06
mucosa-associated lymphoid tissue lympho... 3.173 2.7e-02
non-small cell lung cancer -2.752 1.3e-18
oligodendroglioma -2.500 1.9e-02
osteosarcoma -5.035 2.1e-05
ovarian cancer -3.500 1.4e-08
pancreatic cancer 1.700 1.2e-06
primitive neuroectodermal tumor -2.800 1.0e-05

Gene RIF (24)

AA Sequence

MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKD      1 - 70
DLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSL     71 - 140
GDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLK    141 - 210
LTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRS    211 - 280
EIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD                               281 - 323
//

Text Mined References (55)

PMID Year Title