Property Summary

NCBI Gene PubMed Count 50
PubMed Score 98.55
PubTator Score 97.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
Rheumatoid Arthritis 1.800 2.4e-02
gastric cancer 2.200 4.1e-03
malignant mesothelioma -1.200 2.2e-06
astrocytic glioma -2.100 4.1e-02
oligodendroglioma -2.500 1.9e-02
osteosarcoma -5.035 2.1e-05
ependymoma -2.300 1.7e-09
glioblastoma -2.800 3.2e-06
group 4 medulloblastoma -3.200 1.3e-08
cystic fibrosis 1.423 2.8e-05
medulloblastoma, large-cell -3.300 2.8e-06
primitive neuroectodermal tumor -2.800 1.0e-05
non-small cell lung cancer -2.752 1.3e-18
intraductal papillary-mucinous adenoma (... 2.500 1.5e-03
intraductal papillary-mucinous carcinoma... 1.700 2.8e-02
intraductal papillary-mucinous neoplasm ... 2.800 1.0e-02
colon cancer 2.100 3.0e-02
lung cancer -4.100 8.7e-07
active Crohn's disease 1.712 8.6e-03
active ulcerative colitis 2.119 4.6e-03
pancreatic cancer 1.700 1.2e-06
lung adenocarcinoma -2.000 7.3e-14
adult high grade glioma -2.800 4.7e-07
atypical teratoid/rhabdoid tumor -1.400 1.4e-02
pilocytic astrocytoma -2.700 1.4e-09
lung carcinoma -4.200 2.2e-36
breast carcinoma -1.400 7.8e-16
Breast cancer -2.700 3.2e-07
mucosa-associated lymphoid tissue lympho... 3.173 2.7e-02
ovarian cancer -3.500 1.4e-08

 MGI Phenotype (1)

Gene RIF (21)

PMID Text
26475168 These results suggest that the iEA index or a combination of polymorphisms in EGFR and ANXA3 may serve as predictive factors of drug response, and therefore could be useful for optimal selection of chemotherapy regimens.
26116899 HIV-1 Vpr downregulates the expression of ANXA3 in human monocyte-derived dendritic cells
26095609 Our results suggest that ANXA3 can serve as a novel diagnostic biomarker and that the inhibition of ANXA3 may be a viable therapeutic option for the treatment of CD133+ liver-CSC-driven HCC.
26093083 ANX A3 has roles as a mammary biomarker, regulator and therapeutic target in breast cancer
25267273 findings suggest that ANXA3 plays a role in HCC CSC/CIC maintenance, and that ANXA3 may represent a potential CSC/CIC-specific therapeutic target for improving the treatment of HCC.
24954692 Two different antigenic variants of ANXA3 are present in post-DRE urines and their clinical significance for diagnosis of prostate cancer should be further investigated.
24884814 Urinary calreticulin, annexin A2, and annexin A3 are very likely a panel of biomarkers with potential value for upper tract urothelial carcinoma diagnosis.
24824926 Annexin A3 was upregulated in gastric cancer cells. Deletion of endogenous Annexin A3 significantly inhibited gastric cancer cell proliferation, migration, and invasion.
24815437 Expression of annexin A3 was increased in gastric cancer compared with that in normal gastric tissues. Annexin A3 expression was significantly associated with tumor volume and TNM stage.
24375474 Findings reveal that ANXA3 might play an important role in hepatocellular carcinoma progression and chemoresistance.
23631820 Annexin A3 expression correlates with tumor size and lymph node metastasis.Annexin A3 might be regulated apoptosis by affecting Bcl-2/Bax balance.Annexin A3 was an independent prognostic factor in breast cancer.
23464856 Low ANXA3 expression is associated with radioresistance in nasopharyngeal carcinoma.
23011854 The expression change of Anxa3 can be utilized as a potential indicator for the development, invasion, metastasis and drug resistance of tumors.
22189913 the association of multi-drug resistance with ANXA3, one of the highly expressed proteins in BEL7402/5-FU-resistant hepatoma cell line, was verified
21435174 annexin A3 secretion may be associated with exocytosis and the release of exosomes
21137070 Decreased expression of ANXA3 in papillary thyroid cancer supports the idea that ANXA3 may be an effective marker of microcarcinoma, and a negative predictor of papillary thyroid cancer progression.
21132403 results suggest that annexin-1, annexin-2, and annexin-3 are identified as potential biomarkers associated with lymph node metastasis in lung adenocarcinoma
21055154 AnnexinA3 plays an important role in the initiation and progression of human gallbladder cancer.
20167856 two spliced isoforms of Annexin A3 are expressed differently in human renal cortex and renal-cell carcinoma
20103635 Annexin A3 could be a target for therapeutic intervention and may also serve as a biomarker for drug resistance in ovarian cancer patients.
16236264 ANXA3 is a novel angiogenic factor that induces vascular endothelial growth factor production through the hypoxia-inducible factor-1 pathway

AA Sequence

MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKD      1 - 70
DLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSL     71 - 140
GDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLK    141 - 210
LTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRS    211 - 280
EIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD                               281 - 323
//

Text Mined References (52)

PMID Year Title
26475168 2015 Construction of possible integrated predictive index based on EGFR and ANXA3 polymorphisms for chemotherapy response in fluoropyrimidine-treated Japanese gastric cancer patients using a bioinformatic method.
26095609 2015 ANXA3/JNK Signaling Promotes Self-Renewal and Tumor Growth, and Its Blockade Provides a Therapeutic Target for Hepatocellular Carcinoma.
26093083 2015 Annexin A3 is a mammary marker and a potential neoplastic breast cell therapeutic target.
25267273 2015 Annexin A3 as a potential target for immunotherapy of liver cancer stem-like cells.
24954692 2014 Prostate cancer biomarker annexin A3 detected in urines obtained following digital rectal examination presents antigenic variability.
24884814 2014 A panel of tumor markers, calreticulin, annexin A2, and annexin A3 in upper tract urothelial carcinoma identified by proteomic and immunological analysis.
24824926 2014 Impact of Annexin A3 expression in gastric cancer cells.
24815437 2014 Expression of annexin A3 in gastric cancer and its correlation with proliferation and apoptosis.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24375474 2015 Annexin A3 promotes tumorigenesis and resistance to chemotherapy in hepatocellular carcinoma.
23631820 2013 Annexin A3 is associated with a poor prognosis in breast cancer and participates in the modulation of apoptosis in vitro by affecting the Bcl-2/Bax balance.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23464856 2013 Identification of radioresistance-associated proteins in human nasopharyngeal carcinoma cell lines by proteomic analysis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23011854 2013 The role of annexin A3 playing in cancers.
22558069 2012 Association of common variants in TNFRSF13B, TNFSF13, and ANXA3 with serum levels of non-albumin protein and immunoglobulin isotypes in Japanese.
22446963 2012 Meta-analysis identifies nine new loci associated with rheumatoid arthritis in the Japanese population.
22189913 2012 Proteomic investigation of 5-fluorouracil resistance in a human hepatocellular carcinoma cell line.
21435174 2012 Secretion of annexin A3 from ovarian cancer cells and its association with platinum resistance in ovarian cancer patients.
21269460 2011 Initial characterization of the human central proteome.
21137070 2010 Decreased annexin A3 expression correlates with tumor progression in papillary thyroid cancer.
21132403 2012 Quantitative proteomic analysis identifying three annexins as lymph node metastasis-related proteins in lung adenocarcinoma.
21055154 2010 [Proteomic study of gallbladder cancer, with special reference on the expression and significance of annexin A3].
20167856 2010 Primary cell cultures from human renal cortex and renal-cell carcinoma evidence a differential expression of two spliced isoforms of Annexin A3.
20103635 2010 Increased expression of annexin A3 is a mechanism of platinum resistance in ovarian cancer.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17205602 2007 Differential radioactive quantification of protein abundance ratios between benign and malignant prostate tissues: cancer association of annexin A3.
16236264 2005 Annexin A3 is a potential angiogenic mediator.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15226301 2004 Identification and characterization of the acidic pH binding sites for growth regulatory ligands of low density lipoprotein receptor-related protein-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10662590 PAP I interacts with itself, PAP II, PAP III, and lithostathine/regIalpha.
10391209 1999 Characterization of single-nucleotide polymorphisms in coding regions of human genes.
9550422 1997 Calcium-dependent neutrophil secretion: characterization and regulation by annexins.
9497492 1997 Role of annexins in endocytosis of antigens in immature human dendritic cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8639653 1996 The high-resolution crystal structure of human annexin III shows subtle differences with annexin V.
8626524 1996 Dissociation of cyclic inositol phosphohydrolase activity from annexin III.
8276419 1993 Structure and polymorphisms of the human annexin III (ANX3) gene.
7526843 1994 Annexin 3 is associated with cytoplasmic granules in neutrophils and monocytes and translocates to the plasma membrane in activated cells.
2975506 1988 Placental anticoagulant proteins: isolation and comparative characterization four members of the lipocortin family.
2968983 1988 Five distinct calcium and phospholipid binding proteins share homology with lipocortin I.
2159184 1990 Identity of inositol 1,2-cyclic phosphate 2-phosphohydrolase with lipocortin III.
2138632 1990 Purification and characterization of an abundant cytosolic protein from human neutrophils that promotes Ca2(+)-dependent aggregation of isolated specific granules.
2138016 1990 Characterization of Ca2(+)-dependent phospholipid binding, vesicle aggregation and membrane fusion by annexins.
1830024 1991 Chromosomal localization of the human annexin III (ANX3) gene.