Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.94
PubTator Score 5.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Urinary Bladder Neoplasms 114 0.0 0.0
Disease Target Count
Bladder Neoplasm 112
Disease Target Count P-value
osteosarcoma 7950 1.2e-05
sonic hedgehog group medulloblastoma 467 2.4e-03

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.518 1.2e-05
sonic hedgehog group medulloblastoma 1.100 2.4e-03

Gene RIF (6)

AA Sequence

MEQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDSCDLGLLSSPCWRLPGVYWQ      1 - 70
NGLSPGVQSTLEPSTAKPTEFSWPGTQKQQEAPVEEVGQAEEPDRLRLQQLPWSSPLHPWDRQQDTEVCD     71 - 140
SGCLLERRHPPALQPWRHLPGFSDCLEWILRVGFAAFSVLWACCSRICGAKQP                     141 - 193
//

Text Mined References (13)

PMID Year Title