1. Home
  2. Targets
  3. Annexin-2 receptor

Tbio Annexin-2 receptor

May act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation.

 Comments

Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.94
PubTator Score 5.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Bladder Neoplasm 109
Disease Target Count P-value
osteosarcoma 7933 1.2e-05
sonic hedgehog group medulloblastoma 1482 2.4e-03

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.518 1.2e-05
sonic hedgehog group medulloblastoma 1.100 2.4e-03

Synonym

Accession Q3ZCQ2 Q8NHX5
Symbols AX2R
AXIIR
C5orf39

Gene

ANXA2R

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (4)

 GO Function (1)

 Compartment GO Term (4)

 HCA RNA Cell Line (56)

See all...

Gene RIF (5)

PMID Text
25633185 these subsequent effects might be via suppressing the expression of matrix metalloproteinase 2 and matrix metalloproteinase 9. ... AXIIR participates in angiogenesis, and may be a potential therapeutic target for angiogenesis related diseases
23640736 AXIIR acts as a novel inducer of apoptosis in human cells, partially through activating Caspase-8.
22223826 Results show that AXII and AXIIR play important roles in multiple myeloma (MM) and that targeting the AXII/AXIIR axis may be a novel therapeutic approach for MM.
18636554 annexin II and its receptor axis play a central role in prostate cancer metastasis, and prostate cancer utilizes the hematopoietic stem cell homing mechanisms to gain access to the niche.
16895901 analysis of the annexin II receptor on human marrow stromal cells

AA Sequence 

MEQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDSCDLGLLSSPCWRLPGVYWQ      1 - 70
NGLSPGVQSTLEPSTAKPTEFSWPGTQKQQEAPVEEVGQAEEPDRLRLQQLPWSSPLHPWDRQQDTEVCD     71 - 140
SGCLLERRHPPALQPWRHLPGFSDCLEWILRVGFAAFSVLWACCSRICGAKQP                     141 - 193
//

Text Mined References (11)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25633185 2015 SiRNA directed against annexin II receptor inhibits angiogenesis via suppressing MMP2 and MMP9 expression.
23640736 2013 Annexin II receptor induces apoptosis independent of Annexin II.
22223826 2012 Annexin II interactions with the annexin II receptor enhance multiple myeloma cell adhesion and growth in the bone marrow microenvironment.
18636554 2008 Annexin II/annexin II receptor axis regulates adhesion, migration, homing, and growth of prostate cancer.
16895901 2006 Cloning and characterization of the annexin II receptor on human marrow stromal cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10359570 1999 Annexin II increases osteoclast formation by stimulating the proliferation of osteoclast precursors in human marrow cultures.