Property Summary

NCBI Gene PubMed Count 18
PubMed Score 14.86
PubTator Score 52.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 3.7e-22
colon cancer 1475 2.9e-02
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 1.0
Disease Target Count Z-score Confidence
Trichorhinophalangeal syndrome type II 14 4.032 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
colon cancer -1.600 2.9e-02
psoriasis -1.900 3.7e-22

Gene RIF (3)

PMID Text
26110394 High ANXA13 expression is associated with Refractory Lupus Nephritis.
20701074 Ectopic overexpression of Annexin A13 was likewise sufficient to sensitize malignant breast cancer cells to treatment with Rapamycin.
11961095 The unique, conserved aspects of annexin A13 primary structure, gene organization, and genetic maps identify it as the probable common ancestor of all vertebrate annexins.

AA Sequence

MGNRHAKASSPQGFDVDRDAKKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKS      1 - 70
ELSGNFEKTALALLDRPSEYAARQLQKAMKGLGTDESVLIEVLCTRTNKEIIAIKEAYQRLFDRSLESDV     71 - 140
KGDTSGNLKKILVSLLQANRNEGDDVDKDLAGQDAKDLYDAGEGRWGTDELAFNEVLAKRSYKQLRATFQ    141 - 210
AYQILIGKDIEEAIEEETSGDLQKAYLTLVRCAQDCEDYFAERLYKSMKGAGTDEETLIRIVVTRAEVDL    211 - 280
QGIKAKFQEKYQKSLSDMVRSDTSGDFRKLLVALLH                                      281 - 316
//

Text Mined References (20)

PMID Year Title
26110394 2015 Biomarkers for Refractory Lupus Nephritis: A Microarray Study of Kidney Tissue.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
21184583 2011 Genome-wide association study of theta band event-related oscillations identifies serotonin receptor gene HTR7 influencing risk of alcohol dependence.
20701074 2010 Identification of annexin A13 as a regulator of chemotherapy resistance using random homozygous gene perturbation.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15813707 2005 Structure-function relationship in annexin A13, the founder member of the vertebrate family of annexins.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11961095 2002 Comparative genetics and evolution of annexin A13 as the founder gene of vertebrate annexins.
11581287 2001 KIFC3, a microtubule minus end-directed motor for the apical transport of annexin XIIIb-associated Triton-insoluble membranes.
10871286 2000 Apical membrane targeting of Nedd4 is mediated by an association of its C2 domain with annexin XIIIb.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9503022 1998 Genomic locations of ANX11 and ANX13 and the evolutionary genetics of human annexins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1530946 1992 A strategy for isolation of cDNAs encoding proteins affecting human intestinal epithelial cell growth and differentiation: characterization of a novel gut-specific N-myristoylated annexin.