Property Summary

NCBI Gene PubMed Count 47
PubMed Score 49.72
PubTator Score 45.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
chronic lymphocytic leukemia 1.338 2.8e-03
malignant mesothelioma -1.100 3.2e-05
astrocytic glioma -1.200 2.6e-02
psoriasis -1.500 2.4e-04
oligodendroglioma -1.200 1.5e-14
osteosarcoma -1.553 2.9e-03
group 4 medulloblastoma -2.200 2.2e-05
medulloblastoma, large-cell -2.300 1.7e-04
primitive neuroectodermal tumor -1.500 1.2e-03
acute quadriplegic myopathy 1.023 1.1e-04
pancreatic ductal adenocarcinoma liver m... 1.685 1.2e-02
non-small cell lung cancer -1.266 3.9e-20
intraductal papillary-mucinous adenoma (... 1.100 2.3e-03
intraductal papillary-mucinous carcinoma... 1.200 2.2e-03
intraductal papillary-mucinous neoplasm ... 1.300 3.5e-03
lung cancer -2.200 2.6e-04
nasopharyngeal carcinoma -1.300 2.4e-08
spina bifida -1.080 3.6e-02
Pick disease 1.100 8.4e-05
invasive ductal carcinoma -1.200 1.7e-04
ovarian cancer 1.900 1.0e-04

Gene RIF (22)

PMID Text
25540196 findings suggest that AnxA11 maintains architectural and functional features of the ERES by coordinating with ALG-2 to stabilize Sec31A at the ERES.
25056970 These findings point to a role for the polymorphisms of ANXA11 in sarcoidosis in a Chinese Han population, and may be informative for future genetic studies on sarcoidosis.
24508622 the associations of Anxa11 with Ca(2+)-regulated exocytosis, cytokinesis, sex differentiation, autoimmune diseases, thrombolysis and cancers are summarized--{REVIEW}
24032725 Annexin A11 rs1049550*T allele exerts a significant protective effect on sarcoidosis susceptibility.
23579219 LIFR rs3729740 and possibly ANXA11 rs1049550 may be useful as biomarkers for predicting whether metastatic colorectal cancer patients are sensitive to relevant target regimens, although further validation in large cohorts is needed.
23151485 ANXA11 SNPs are associated with sarcoidosis in African Americans.
21562576 ANXA11 rs1049550 single nucleotide polymorphism is the susceptibility marker in sarcoidosis, at least in Caucasians.
20805159 Data confirm the strong association between variations in ANXA11 and sarcoidosis and support the hypothesis that ANXA11 represents a strong genetic risk factor for sarcoidosis.
20805159 Observational study of gene-disease association. (HuGE Navigator)
20093729 A7 and A11 have sequence repeats that form novel structures, called YP pro-beta helices, that are characterized by an ability to interact with one another
20093723 analysis of the sarcoidosis-associated variant of annexin A11
19484149 Immunohistochemistry analyses indicated that annexin A11 immunointensity inversely correlated with HMOX1 immunoreactivity in 142 ovarian cancer patients.
19345290 These findings indicate that the polymorphisms of ANXA6 are associated with osteonecrosis of the femoral head.
19345290 Observational study of gene-disease association. (HuGE Navigator)
19165924 The strongest association signal maps to the ANXA11 (annexin A11) gene on chromosome 10q22.3.
19165924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
15197175 Annexin 11-depleted cells failed to complete cytokinesis and died by apoptosis, demonstrating an essential role for annexin 11.
12805373 annexin XI associates with the mitotic spindles and might play a role in cell division
12601007 calcium- and cell cycle-dependent association with the nuclear envelope
12445460 The penta-EF-hand domain of ALG-2 interacts with the amino-terminal domain of annexin XI in a Ca2+-dependent manner.
11883939 Pro/Gly/Tyr/Ala-rich hydrophobic region in AnxN masked the Ca(2+)-dependently exposed hydrophobic surface of ALG-2.

AA Sequence

MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANM      1 - 70
PNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQP     71 - 140
PGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLR    141 - 210
KAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYE    211 - 280
IKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDEST    281 - 350
NVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEE    351 - 420
GMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTS    421 - 490
GDYRKILLKICGGND                                                           491 - 505
//

Text Mined References (52)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25724726 2015 Prostate cancer-associated autoantibodies in serum against tumor-associated antigens as potential new biomarkers.
25540196 2015 A new role for annexin A11 in the early secretory pathway via stabilizing Sec31A protein at the endoplasmic reticulum exit sites (ERES).
25056970 2014 Annexin A11 (ANXA11) gene polymorphisms are associated with sarcoidosis in a Han Chinese population: a case-control study.
24508622 2014 Annexin A11 in disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24032725 2013 Annexin A11 gene polymorphism (R230C variant) and sarcoidosis in a Portuguese population.
23579219 2013 Feasibility of proposed single-nucleotide polymorphisms as predictive markers for targeted regimens in metastatic colorectal cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23151485 2013 Association of ANXA11 genetic variation with sarcoidosis in African Americans and European Americans.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
22936702 2013 Genome-wide association analysis reveals 12q13.3-q14.1 as new risk locus for sarcoidosis.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21562576 2011 Functional variant ANXA11 R230C: true marker of protection and candidate disease modifier in sarcoidosis.
21269460 2011 Initial characterization of the human central proteome.
20805159 2010 First independent replication study confirms the strong genetic association of ANXA11 with sarcoidosis.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20093729 2009 Novel protein ligands of the annexin A7 N-terminal region suggest pro-beta helices engage one another with high specificity.
20093723 2009 Characterisation of the sarcoidosis-associated variant of annexin A11.
19946888 2010 Defining the membrane proteome of NK cells.
19724273 2009 S100A6 binds to annexin 2 in pancreatic cancer cells and promotes pancreatic cancer cell motility.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19484149 2009 Suppression of annexin A11 in ovarian cancer: implications in chemoresistance.
19345290 2009 Polymorphisms in the Annexin gene family and the risk of osteonecrosis of the femoral head in the Korean population.
19165924 2008 Genome-wide association study identifies ANXA11 as a new susceptibility locus for sarcoidosis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18256029 2008 Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15197175 2004 Annexin 11 is required for midbody formation and completion of the terminal phase of cytokinesis.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12805373 2003 Dissecting the cellular functions of annexin XI using recombinant human annexin XI-specific autoantibodies cloned by phage display.
12601007 2003 Calcium- and cell cycle-dependent association of annexin 11 with the nuclear envelope.
12577318 2003 Calcyclin (S100A6) regulates pulmonary fibroblast proliferation, morphology, and cytoskeletal organization in vitro.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445460 2002 The penta-EF-hand domain of ALG-2 interacts with amino-terminal domains of both annexin VII and annexin XI in a Ca2+-dependent manner.
11883939 2002 ALG-2 interacts with the amino-terminal domain of annexin XI in a Ca(2+)-dependent manner.
11013079 2000 Annexin A11 (ANXA11) gene structure as the progenitor of paralogous annexins and source of orthologous cDNA isoforms.
10037139 1999 Characterization of the calcyclin (S100A6) binding site of annexin XI-A by site-directed mutagenesis.
9503022 1998 Genomic locations of ANX11 and ANX13 and the evolutionary genetics of human annexins.
9268363 1997 Calcium-dependent binding of sorcin to the N-terminal domain of synexin (annexin VII).
9188810 1997 Translocation of annexin XI to neutrophil subcellular organelles.
8639854 1996 Isolation by calcium-dependent translation to neutrophil-specific granules of a 42-kD cytosolic protein, identified as being a fragment of annexin XI.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7508441 1994 The 56K autoantigen is identical to human annexin XI.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.
1299619 1992 Specific binding of CAP-50 to calcyclin.