Property Summary

NCBI Gene PubMed Count 22
PubMed Score 23.72
PubTator Score 25.31

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
26361422 Annexin A10 expression is associated with poor clinical behavior and can be used a supportive surrogate marker of the serrated neoplasia pathway in invasive colorectal carcinomas.
25395067 there is a correlation between high ANXA10 expression and serrated growth pattern in colorectal carcinoma
25081749 Our results indicated that ANXA10 expression is implicated in gastric programming in serrated-pathway-associated colorectal carcinoma.
24909058 ANXA10+ MSI-H colon carcinomas are characterized by serrated pathway features, including proximal location, female predominance, and high frequencies of CIMP-H status and MLH1 methylation.
24625416 immunohistochemistry for annexin A10 may be a useful marker to distinguish sporadic from Lynch syndrome-associated microsatellite-unstable colon cancer
24024557 Our study results indicate that the inclusion of ANXA10 in an immunohistochemical panel will be helpful in the differential diagnosis of adenocarcinoma of an unknown primary site.
23715859 Overexpression of annexin A10 increases their sensitivity to apoptosis and reduces colony formation.
23073794 The apoptosis rate in PGC-Fu-ANXA10 group was significantly higher than in PGC-Fu group.
23029062 ANXA10 is an indicator of cellular proliferation in OSCCs. Our results suggested that ANXA10 expression might indicate cellular proliferation and ANXA10 might be a potential therapeutic target for the development of new treatments for OSCCs.
21979422 We conclude that ANXA10 may be a clinical relevant marker for predicting outcome in both early and advanced stages of bladder cancer.
21175800 ANXA10 protein expression is a novel marker of gastric differentiation, and is differentially expressed in intestinal and diffuse type gastric carcinoma, with opposite prognostic significance.
20664964 ANXA10 was aberrantly regulated in gastric carcinoma and suggest that down-regulation of ANXA10 might be involved in gastric carcinogenesis.
19582876 Reduced expression and homozygous deletion of annexin A10 is associated with gastric carcinoma.

AA Sequence

MFCGDYVQGTIFPAPNFNPIMDAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRDLIGD      1 - 70
MREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQ     71 - 140
EDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNKSYQQLRLV    141 - 210
FQEFQNISGQDMVDAINECYDGYFQELLVAIVLCVRDKPAYFAYRLYSAIHDFGFHNKTVIRILIARSEI    211 - 280
DLLTIRKRYKERYGKSLFHDIRNFASGHYKKALLAICAGDAEDY                              281 - 324
//

Text Mined References (22)

PMID Year Title
26361422 2015 Annexin A10 expression in colorectal cancers with emphasis on the serrated neoplasia pathway.
25416956 2014 A proteome-scale map of the human interactome network.
25395067 2015 Annexin A10 is a marker for the serrated pathway of colorectal carcinoma.
25081749 2015 Aberrant expression of annexin A10 is closely related to gastric phenotype in serrated pathway to colorectal carcinoma.
24909058 2014 Annexin A10 expression correlates with serrated pathway features in colorectal carcinoma with microsatellite instability.
24625416 2014 Immunohistochemistry for annexin A10 can distinguish sporadic from Lynch syndrome-associated microsatellite-unstable colorectal carcinoma.
24024557 2013 Annexin A10 is an immunohistochemical marker for adenocarcinoma of the upper gastrointestinal tract and pancreatobiliary system.
23715859 2014 The tumor suppressor annexin A10 is a novel component of nuclear paraspeckles.
23073794 2012 Effects of over-expression of ANXA10 gene on proliferation and apoptosis of hepatocellular carcinoma cell line HepG2.
23029062 2012 Annexin A10 in human oral cancer: biomarker for tumoral growth via G1/S transition by targeting MAPK signaling pathways.
21979422 2011 Low ANXA10 expression is associated with disease aggressiveness in bladder cancer.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21175800 2011 Expression and prognostic significance of gastric-specific annexin A10 in diffuse- and intestinal-type gastric carcinoma.
20664964 2010 Decreased expression of annexin A10 in gastric cancer and its overexpression in tumor cell growth suppression.
19582876 2009 Reduced expression and homozygous deletion of annexin A10 in gastric carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12000734 2002 Down-regulation of annexin A10 in hepatocellular carcinoma is associated with vascular invasion, early recurrence, and poor prognosis in synergy with p53 mutation.
10458909 1999 Novel human and mouse annexin A10 are linked to the genome duplications during early chordate evolution.