Property Summary

NCBI Gene PubMed Count 224
PubMed Score 775.42
PubTator Score 533.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Disease of anatomical entity 25 0.0 1.0
Schizophrenia 503 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 4.516 2.3

Expression

  Differential Expression (36)

Disease log2 FC p
Waldenstrons macroglobulinemia 2.006 4.3e-02
esophageal adenocarcinoma -3.200 4.3e-02
astrocytoma 1.200 4.2e-03
glioblastoma 4.500 3.1e-04
chronic lymphosyte leukemia -2.300 3.0e-09
posterior fossa group B ependymoma 4.300 1.2e-20
medulloblastoma, large-cell -1.200 6.3e-03
Duchenne muscular dystrophy 2.169 2.6e-08
autosomal dominant Emery-Dreifuss muscul... 2.029 1.9e-03
limb girdle muscular dystrophy 2A 1.622 1.1e-04
Becker muscular dystrophy 1.045 3.2e-02
fascioscapulohumeral muscular dystrophy 1.284 7.1e-04
juvenile dermatomyositis 1.702 5.6e-10
Amyotrophic Lateral Sclerosis 1.256 9.6e-04
acute quadriplegic myopathy 2.129 6.4e-06
primary pancreatic ductal adenocarcinoma 2.990 2.0e-04
lung cancer -3.900 4.2e-02
pancreatic cancer 2.900 2.1e-04
breast carcinoma -1.700 4.7e-05
fibroadenoma -1.200 2.3e-02
pediatric high grade glioma 2.800 5.3e-06
atypical teratoid/rhabdoid tumor 1.400 3.0e-02
group 4 medulloblastoma -2.000 2.8e-04
pilocytic astrocytoma 2.300 3.6e-07
subependymal giant cell astrocytoma 5.330 3.7e-03
nasopharyngeal carcinoma -2.000 2.7e-04
Breast cancer -3.500 3.5e-19
lung carcinoma -2.800 1.6e-39
spina bifida -1.041 4.0e-02
gastric carcinoma 2.100 1.4e-02
ductal carcinoma in situ -1.800 1.9e-04
invasive ductal carcinoma -2.200 1.6e-04
ulcerative colitis 5.500 3.5e-12
ovarian cancer 3.700 1.0e-06
pituitary cancer -3.000 1.6e-05
dermatomyositis 1.900 1.3e-02

Protein-protein Interaction (303)

GNAT3   GRM8   CORT   F2RL2   P2RY10   CXCR6   CCL21   CXCL11   FFAR1   FFAR3   NPFF   GRM6   CCL25   CCL16   FFAR2   MLNR   ADCY6   GNRH2   GALR2   HCRT   HCRTR1   HCRTR2   CXCL13   KALRN   ADCY3   ADCY9   GALR3   GABBR2   DYSF   TRIO   S1PR2   UTS2   ADCY5   NTSR2   GNA14   S1PR4   F2   C3   C5   KNG1   GNRH1   OXT   AVP   POMC   PENK   PDYN   GCG   PPY   NPY   GAST   PPBP   PF4   CXCL10   GNAI2   APP   EDN1   CCK   ANXA2   GRP   ANXA6   GNAI3   NMB   CXCL1   NPS   SAA1   ADORA3   PYY   CXCL8   MLN   CCL5   EDN3   DRD2   ADRA2C   GNAZ   CXCL2   CXCL3   TAC1   PMCH   TRH   EDN2   TACR2   S1PR1   FPR1   CNR1   C5AR1   TBXA2R   DRD4   GAL   EDNRB   CXCR1   CXCR2   FPR3   FPR2   GRK2   EDNRA   TACR1   PTAFR   ACKR3   F2R   NPY1R   PIK3R1   HTR2C   NMBR   TACR3   GNA11   BDKRB2   GRPR   OXTR   GNA15   SSTR1   SSTR2   GNRHR   NTSR1   NTS   SSTR4   CCKAR   CCKBR   CCR1   CCR7   CXCR5   SSTR3   GRK5   CNR2   TRHR   PTGER1   SSTR5   HRH1   OPRM1   APLNR   DRD3   AVPR1A   ADCY8   OPRD1   OPRK1   OPRL1   CASR   P2RY2   GRM5   CCR2   PIK3CA   CXCL5   PTGFR   PTGER3   LPAR6   CCR10   GPR4   XCR1   BDKRB1   GALR1   GCGR   P2RY1   AVPR1B   XCL1   MTNR1A   CXCL12   NPBWR1   NPBWR2   NMU   PIK3CG   HCAR3   NPY2R   MTNR1B   CXCR3   GNAQ   NPY4R   P2RY4   CCR3   CCR4   CCR5   CCR6   CCR8   CCR9   ADCY7   F2RL1   CCL23   CAV3   PROK1   TAS2R38   TAS2R39   TAS2R40   TAS2R41   TAS2R43   TAS2R31   TAS2R45   TAS2R46   TAS2R30   TAS2R19   TAS2R20   TAS2R50   TAS2R60   GNG2   CXCR4   SST   GNB1   GNAI1   CCL20   CXCL6   QRFP   PLCB2   PLCB3   GNA12   CXCL9   ADCY2   ADCY1   GRM1   GPR17   PNOC   GPR18   GNA13   GRM2   GRM7   GRM3   GRM4   P2RY6   PLCB4   P2RY14   LTB4R   KISS1   GPR68   NPY5R   C3AR1   NMS   GPRC6A   PIK3R6   NPSR1   TRIM72   UTS2B   TAS2R42   ARHGEF25   MT-RNR2   GPR65   NPW   PROKR2   ADCY4   NPB   PROKR1   HCAR2   OXER1   RXFP4   RLN3   PIK3R5   LPAR1   GHSR   ARHGEF1   KISS1R   MCHR2   P2RY11   QRFPR   OXGR1   GNRHR2   F2RL3   S1PR3   GPER1   LPAR4   MCHR1   CCL19   P2RY13   SUCNR1   HCAR1   NMUR2   NPFFR1   LPAR5   S1PR5   P2RY12   CXCL16   HRH4   NMUR1   LPAR2   PROK2   LTB4R2   PLCB1   CCL28   HEBP1   CYSLTR2   RXFP3   TAS2R16   TAS2R14   TAS2R13   TAS2R10   TAS2R9   TAS2R8   TAS2R7   TAS2R5   TAS2R4   TAS2R3   TAS2R1   ARHGEF12   XCL2   GABBR1   GHRL   LPAR3   TAC3   OPN4   UTS2R   APLN   GPR132   CYSLTR1   GPR55   CCL27   HRH3   INSL5   NPFFR2   PTGDR2  

Gene RIF (174)

PMID Text
27012521 Data show that high density lipoprotein (HDL) up-regulated expression of annexin A1 (ANXA1) in HUVEC vascular endothelial cells in a dose-dependent (Fig. 1A-B) and time-dependent manners.
26885535 AnxA1 and its mimetic peptides inhibit neutrophil tissue accumulation by reducing leukocyte infiltration and activating neutrophil apoptosis.
26803520 We conclude that ANX-A1 is an important regulator of mast cell reactivity to compound 48/80 exerting a negative feedback effect through a mechanism that depends at least partly on the FPR receptor
26398190 increased AnxA1 levels were associated with a systemic inflammatory phenotype in preeclampsia.
26369530 results suggest that overexpression of CRISP-3 in prostate tumor may maintain higher PSA expression and lower ANXA1 expression
26312765 Annexin A1 is involved in the acquisition and maintenance of a stem cell-like/aggressive phenotype in prostate cancer cells with acquired resistance to zoledronic acid.
26137966 ANXA1 is overexpressed in familial breast cancer patients with BRCA1/2 mutations and correlated with poor prognosis features: triple negative and poorly differentiated tumors.
26135980 Data show that elevated levels of annexin A1 are associated with small cell lung cancer {SCLC) brain metastasis.
26072160 data indicate the involvement of ANXA1Ac2-26 in the altered expression of genes involved in tumorigenic processes, which could potentially be applied as a therapeutic indicator of cervical cancer
26000884 Within the basal subtype of breast cancer, patients show significantly poorer overall survival associated with higher expression of annexin A1.
25983101 Overexpression of ANXA1 induced by low-concentration Arsenic Trioxide (ATO) makes cancer cells more resistant to the agent via activated ERK MAPKs. Specific silencing of ANXA1 increased the sensitivity of cancer cells to ATO treatment.
25899628 ANXA1 negatively regulated the step of viral RNA replication rather than that of viral entry in human hepatocytes.
25866182 These findings establish a central role for ANXA1 in the cell migration through the activation of NFkappaB, ERK1/2 and RhoA.
25854353 Loss of ANXA1 is associated with lymphatic metastasis in pancreatic ductal adenocarcinoma.
25664854 Patients with active inflammatory bowel disease had elevated levels of secreted ANXA1-containing exosomes in sera.
25592491 These results suggested that ANXA1, which enhanced breast cancer invasion and metastasis under hypoxia, were significantly associated with the worst patient outcome in triple-negative breast cancer
25536365 This data suggests that ANXA1-regulated miR26b* and miR562 may play a role in wound healing and tumor-induced endothelial cell tube formation by targeting NF-kappaB expression and point towards a potential therapeutic target for breast cancer.
25510623 Study provides new insights on the role of ANXA1 protein in pancreatic cancer progression and suggest that ANXA1 protein could regulate metastasis by favouring cell migration/invasion.
25490767 ANXA1 may contribute to the regulation of tumor growth and metastasis through paracrine mechanisms that are mediated by FPR2/ALX
25460034 Cardioprotective potential of annexin-A1 mimetics in myocardial infarction
25412936 Increased expression of ANXA1 protein associates with aggressive progression and poor prognosis in hepatocellular carcinoma patients.
25362540 Identify signaling pathways involved in annexin A1 pro-invasive role and suggest that externalized full-length annexin A1 interacts with formyl peptide receptors in a juxtacrine manner while ANXA 2-28 release allows autocrine and paracrine interaction.
25344217 This work suggests that circulating IgG for ANXA1-derived peptide antigens may have both diagnostic and prognostic values for breast cancer although further screening is needed to identify more such peptide antigens derived from tumor-associated antigens.
25337195 ANXA1 may become a promising marker to predict the recurrence and drug resistance of bladder cancer and provide guidance for surveillance.
25322804 Annexin A1 may be a potential biomarker for the development and prognosis of NPC.
25300907 The expression levels of Hsp90-beta and annexin A1 positively correlated and such co-overexpression of Hsp90-beta and annexin A1 contributed to lung cancer diagnosis.
25201101 the co-upregulated expression of mast cell chymase and ANXA1-FPR1 system in ectopic endometrium suggests their involvement in the development of endometriotic lesions.
25038797 Data revealed important functions of ANXA1 in tumorigenesis and cancer development.
25031270 These results demonstrate that a necroptosis pathway, likely mediated by annexin 1 acting through the FPR1 receptor, contributes to Stevens-Johnson syndrome (SJS) and toxic epidermal necrolysis.
25028131 The broken dialog between ANXA1 and CK18 in normal breast tissues may play a critical role in breast cancer development.
24810927 high expression of ANXA1 is associated with poor therapeutic response and adverse outcomes in rectal cancer patients treated with neoadjuvant concurrent chemoradiation therapy (CCRT).
24790181 These data show a multiantibody composition in lupus nephritis, where IgG2 autoantibodies against alpha-enolase and annexin AI predominate in the glomerulus and can be detected in serum.
24719523 both the AnxA1 and Gal-1 anti-inflammatory proteins are deregulated in precancerous gastric lesions
24591769 Urinary ANXA1 protein is detectable glomerulopathy patients except those with minimal change disease.
24551299 nuclear ANXA1 may be potentially used as a prognostic biomarker for esophageal squamous cell carcinoma.
24525704 This is the first study to assess lipoxin A4 and annexin A1 levels in wheezy infants.
24480285 The expression levels of three putative HA-regulated proteins (TALDO, ANXA1 and EF2) in control, H2O2-, HA- and HA/H2O2-treated OA chondrocytes were verified by Western blotting and the results indeed support the notion that HA acts in anti-oxidation
24464914 AnxA1 participates in a paradigm in which malignant prostate epithelial cells that are not cancer stem cells are induced to gain cancer stem cell-like properties.
24300781 Annexin1 was abundantly detected in each epidermal layer in lupus lesional skin. Additionally, anti-annexin1-IgG was higher in SLE patients with arthritis and negatively correlated with white blood cells (WBC).
24282368 Upregulated ANXA1 expression may be associated with carcinogenesis, progression, invasion and metastasis of gastric adenocarcinoma.
24242295 In the current study, we review the important biological functions of annexin A1 in different tumors.
24156336 Anxa1 might specifically function either as a tumor suppressor or a tumor promoter candidate for certain cancers. [Review]
24130820 Loss of ANXA1 expression may support inflammation during IBD and can serve as a biomarker of disease progression
24118254 result of the present study suggest that ANXA1 complex coordinates the actions of PKA and PKC to control the distribution of oxytocin vesicles between the axon and the cell body
23991102 findings provide both clinical and mechanistic evidences that FoxM1 contributes to glioma development by directly up-regulating Anxa1 expression
23958797 annexin A1 has important anti-inflammatory effects in rheumatoid arthritis (RA).Patients with RA had reduced peripheral blood monocyte expression of annexin A1 in response to glucocorticoids compared with healthy control individuals.
23786757 Annexin A1 expression can potentially be used as a predictive biomarker to select Ooral squamous cell carcinoma patients with moderate/poorly differentiated tumor who may benefit from docetaxel, cisplatin and 5-fluorouracil induction chemotherapy.
23754495 Used proteomics to study Annexin A1 (Anxa1) interacting proteins in the Philadelphia-positive KCL22 cell line.
23727357 These results show for the first time that SUMOylation can be regulated by an external signal (EGF) and indicate the presence of a cross-talk between the N-terminal and C-terminal domains of ANXA1 through post-translational modifications.
23674846 Suggest annexin A1 may serve as a new immunohistochemical marker of cholangiocarcinoma.
23638088 Annexin A1 is exposed on the surface of early apoptotic cells and suppresses CD8+ T cell immunity.
23431236 Results have provided evidence that galectin-1 and mainly annexin-A1 are overexpressed in both gastritis and gastric cancer, suggesting a strong association of these proteins with chronic gastric inflammation and carcinogenesis.
23413360 Up-regulation of annexin A1 gene expression and protein points to this protein as a biomarker for transverse (T)-tubular repair.
23403091 data support a significant correlation between Annexin A1 expression and pathological differentiation grade, and a functional role of Annexin A1 in inhibiting cell proliferation and cell differentiation in OSCC
23376147 Annexin A1 down regulation in patients with bladder pain syndrome might decrease cell survival and damage urothelial function.
23341933 Overexpression of ANXA1 might be mediated by human papillomavirus (HPV) E6 in penile squamous cell carcinoma of patients with high-risk HPVs.
23277546 detection of a selective loss of ANXA1 in the plasma and cerebrovascular endothelium of patients with multiple sclerosis
23241962 a novel epithelial FPR1/NOX1-dependent redox signaling pathway that promotes mucosal wound repair.
23154128 Annexin A1 is involved in reducing the production of pro-inflammatory mediators in smooth muscle cells derived from human atherosclerotic plaques.
23029153 N- terminal peptide of Annexin A1 Ac2-26 is able to stimulate direct migration of WS1 cells in high glucose treatment possibly due to the increased receptor expression observed in hyperglycemia conditions
23017499 AnxA1 protein correlates positively with salivary cortisol, indicating that cortisol is most likely a regulator of AnxA1 in human saliva.
22929401 The upregulation of annexin A1 was associated with poor post-surgical survival time and lymphatic metastasis of lung cancer patients
22909323 A novel role for ATM kinase activity in the dynamic exchange of proteins in dna damage response complexes and identifies a role for ANXA1 in cellular radioprotection.
22792315 Depletion of annexin A1 or A2 alters the retrograde transport of shiga toxin but not ricin, without affecting toxin binding or internalization.
22777765 The data suggested that in lung fibroblasts annexin A1 regulates TNF-induced proliferation and inflammatory responses, which depend on formyl-peptide receptor 2. Annexin A1 also mediates the expression of glucocorticoid-induced leucine zipper.
22773844 VEGF-induced decrease of miR-196a expression may participate to the angiogenic switch by maintaining the expression of ANXA1 to levels required to enable p38-ANXA1-dependent endothelial cell migration and angiogenesis in response to VEGF.
22701020 Endothelial microparticles are incorporated by endothelial cells in an annexin I/phosphatidylserine receptor-dependent manner and protect target cells against apoptosis.
22640735 these results indicate that ANXA1 functions as a positive regulator of MMP-9 expression and invasion of breast cancer cells through specific activation of the NF-kappaB signaling pathway.
22613333 Data show that hypoxia upregulates the expression of Annexin A1 in lung adenocarcinoma A549 cells, in which process reactive oxygen species (ROS)-NF-kappaB may paticipate in.
22610094 N-terminal region was dispensable for AnxA1-induced FPR2/ALX down-regulation in both the homologous and heterologous desensitization modes.
22378018 We conclude that biologically active AnxA1 may play a role in the anti-inflammatory properties of ATRA-treated APL cells during the process of granulocytic differentiation.
22164217 Propofol inhibits the activation of p38 through up-regulating the expression of annexin A1 to exert its anti-inflammation effect
22116825 Cleavage of annexin A1 by ADAM10 during secondary necrosis generates a monocytic "find-me" signal.
22056994 ANXA1 and, to a lesser extent, ANXA4 were detected on late but not early apoptotic HeLa cells.
21903368 Eurycomanone suppresses the expression of annexin 1 or lipocortin I protein that is involved in cell proliferation and differentiation.
21420379 Annexin A1 seemed to be positively upregulated during starvation to promote autophagic degradation.
21412170 MG53, annexin A1, and dysferlin localize to the t-tubule network and show enriched labeling at longitudinal tubules of the t-system in overstretch
21398608 Data sugget the existence of an endogenous network in anti-inflammation centered on PMN AnxA1 and activated by selective FPR2/ALX agonists.
21383699 ANXA1 can constitutively activate NF-kappaB in breast cancer cells through the interaction with the IKK complex
21365324 The Annexin A1 is proposed to function importantly in the progression of lung adenorcinoma.
21254404 This study identifies annexin A1 as part of the anti-inflammatory pattern of apoptotic cells and links the activation of FPRs to established signalling pathways triggering anti-inflammatory responses.
21195640 Suggest that high Annexin A1 expression may have a stabilising effect in asymptomatic patients with less echolucent atherosclerotic plaques.
21132403 results suggest that annexin-1, annexin-2, and annexin-3 are identified as potential biomarkers associated with lymph node metastasis in lung adenocarcinoma
21127395 Twenty paired specimens of colorectal cancer and adjacent normal tissues were examined for K-ras mutations and annexin A1 expression.
21122411 The benign lesions with positive ANXA1 and/or ANXA2 expression showed mild to severe atypical hyperplasia of the gallbladder epithelium. The positive rates of ANXA1 and/or ANXA2 were significantly lower in the well-differentiated adenocarcinoma.
20970165 annexin A1 expression was consistently lost in 52 (91%) intestinal-type sinonasal adenocarcinomas, as compared with the normal epithelium.
20962261 We show that ANXA1 is fundamental for brain homeostasis
20930115 These observations suggest a novel signaling role for ANXA1 in mitogen-activated proliferation of breast tumor epithelial cells that is mediated via activation of FPR1 and FPR2.
20924191 Decreased expression of ANXA1 is a common event in hilar cholangiocarcinoma and is significantly correlated with the poor outcome of patients with cholangiocarcinoma, suggesting a potential role of ANXA1 in cancer development and progression.
20872967 Data suggest that increased expression of hnRNP A1, Ezrin, tubulin beta-2C and Annexin A1 in SLNMM indicate a significantly elevated early colorectal cancer metastasis.
20821804 Strikingly, forced AnxA1 expression in metastatic mouse and human mammary carcinoma cells reversed epithelial-to-mesenchymal transition and abolished breast cancer metastasis.
20679535 A novel proinflammatory action of an amino-terminally truncated form of AnxA1 generated by calpain I proteolysis has a potential role in transcellular migration.
20665809 results indicate ANXA1 is expressed in both gastric adenocarcinoma and normal tissue; in gastric adenocarcinoma, ANXA1 is expressed in cytoplasm and nucleus and its nuclear localization correlates with advanced disease stage and peritoneal dissemination
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602103 Expression of ANXs was different in histologic subtypes of penile carcinomas. Strong expression of ANX AI and ANX AIV in the invasion front seems to indicate a higher risk of lymph node metastasis.
20558817 Propose a novel mechanism to explain the antiinflammatory actions of cromones on neutrophil trafficking involving annexin A1.
20549082 there is increased expression of genes coding for annexin-1 and galectin-1 in nasal polyps and when systemic corticosteroids are given, the mean gene expression of annexin-1 decreases significantly and the mean expression of galectin-1 remains unaltered
20398702 ANXA1 is constitutively highly expressed in glucocorticoid-resistant ATL cell lines, suggesting a possible role of ANXA1 in promoting leukemogenesis and also in immunosuppression associated with HTLV-I infection.
20359522 Ubiquitination of annexin A1 may play an important role in mutagenesis, an initial step of cell transformation.
20353277 ANXA1 may play a multifaceted role in breast cancer development, progression, and metastases.
20308542 show here that AnxA1 expression is associated with a highly invasive basal-like breast cancer subtype both in a panel of human breast cancer cell lines as in breast cancer patients.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20163912 ANXA1, which was recently reported as a possible tumor suppressor gene, can protect cells from heat-induced growth arrest and DNA damage in breast cancer cells.
20061392 phosphorylation of annexin 1 regulates the angiogenic effect that is associated with the activation of the p38/LIM kinase 1 axis by VEGF
20025479 Annexin-I overexpression is associated with tumour progression and independently predicts inferior disease-specific and metastasis-free survival in urinary bladder urothelial carcinoma.
20007579 Anx A1 efficiently prevents secretion of proinflammatory cytokines in macrophages after ingestion of secondary necrotic cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19850308 The neutrophil expression of ANXA1 was significantly increased in patients with coronary artery disease
19767728 Expression of annexin-1 is altered with the grade of malignancy in neuroepithelial tumors but it is not associated with patient survival.
19428102 we revealed the mRNA expression of annexin 1 was negatively correlated with PU.1 mRNA expression in 43 primary AML specimens
19351789 there is direct role for decreased ANXA1 expression in prostate carcinogenesis and enhancing tumor aggressiveness via the upregulation of IL-6 expression and activity.
19289595 hairy cell leukemia (HCL) lacking CD25 and annexin-A1 behave clinically differently and can be separated from HCL on diagnosis.
19208747 Loss of Annexin-1 is associated with invasive breast cancer.
19204938 Data suggest that E6AP may play a role in controlling the diverse functions of annexin A1 through the ubiquitin-proteasome pathway.
19104500 glucocorticoids regulate the expression and function of annexin A1 in opposing ways in innate and adaptive immune cells to mediate the resolution of inflammation. Review.
19101730 Loss of ANXA1 is frequent and an early event during oral carcinogenesis; ANXA1 could contribute to maintaining epithelial differentiation in oral squamous cell carcinoma.
19076685 Annexin A1 dysregulation was observed early in laryngeal carcinogenesis, in intra-epithelial neoplasms; it was not found related to prognostic parameters, such as nodal metastases
18794547 Report the occurrence of autoantibodies to annexin I, 14-3-3 theta and LAMR1 in prediagnostic lung cancer sera.
18776816 expression lost in 79% of breast carcinomas, no difference in expression between primary breast carcinoma and lymph node metastasis
18706208 Annexin-1 is overexpressed in eutopic endometrium and presents in the peritoneal fluids of patients with endometriosis, and may play a role in the pathogenesis of endometriosis.
18673418 decreased expression contributes to the cancerous progression of oral squamous cell carcinoma
18663355 demonstrated a novel mechanism of post-transcriptional regulation of ANXA1 expression and identified miR-196a as a marker of esophageal cancer
18652761 Results describe decreased expression of annexin A1 during the progression of cervical neoplasia.
18594025 PMN-derived microparticles contain functionally active AnxA1 that confers them anti-inflammatory properties
18566442 N-terminal portion of annexin 1 plays some role in the pathogenesis of acute exacerbation in idiopathic pulmonary fibrosis patients
18396684 Annexin I can modulate pancreatic carcinoma cell cycle, promote cell proliferation, stimulate cell growth, and suppress apoptosis in pancreatic carcinoma cells.
18297688 Nuclear localization of annexin A1 is associated with oral squamous cell carcinoma
18164291 analysis of translocation and assembly at the plasma membrane and the nuclear envelope
17994624 Human clinical specimens showed that ANNA1 expression was reduced in bladder transitional cell carcinomas(TCC) compared to normal urothelium.
17971499 Cell surface ANXA1 synthesis is capable of blocking beta 2-integrin adhesion in PMNs. Fluticasone propionate does not cause ANXA1 synthesis or nuclear transport of cytosolic gIVaPLA2 & thus does not block beta2-integrin adhesion.
17932043 Ca(2+)-dependent binding of S100A11 to ANXA1 facilitated the binding of the latter to cPLA(2), resulting in inhibition of cPLA(2) activity
17873281 the confluence-dependent interaction of cPLA(2)alpha and annexin A1 at the Golgi acts as a novel molecular switch controlling cPLA(2)alpha activity and endothelial cell prostaglandin generation.
17681950 proteinase 3 has a critical role in annexin 1 cleavage in activated neutrophils
17676665 HIV-1 gp120 upregulates the expression of annexin A4 and V in umbilical cord blood mononuclear cells and T-cell lines but downregulates the expression of annexin A1 in umbilical cord blood mononuclear cells
17626739 LMP1 mediates serine phosphorylation of Annexin I via the PKC pathway.
17372018 Annexin-1 and peptide derivatives play a role in promoting the resolution of inflammation.
17340616 Results demonstrated that ANXA1 plays a regulatory role in laryngeal cancer cell growth.
17317721 the role of the homeostatic antiinflammatory axis centered on annexin 1 in cerebral microvascular dysfunction and tissue injury associated with middle cerebral artery occlusion and reperfusion
17215481 Annexin 1 has roles in a variety of inflammatory pathways, on cell proliferation machinery, in the regulation of cell death signaling, in phagocytic clearance of apoptosing cells, and most importantly in the process of carcinogenesis [review]
17023068 The identification of annexin 1 as a substrate for HLE supports the model in which annexin 1 participates in regulating leukocyte emigration into inflamed tissue.
17019707 Decrease of annexin-I expression is associated with bladder cancer development
17008549 CD4+ cells from patients with rheumatoid arthritis showed a marked up-regulation of annexin-1 expression; annexin-1 is a molecular "tuner" of TCR signaling
16984915 Ca2+ entering through a disruption locally induces annexin A1 binding to membranes, initiating emergency fusion events whenever and wherever required.
16973129 In view of the wide range of endogenous ligands known to interact with FPRL-1, including the anti-inflammatory protein annexin-A1, we speculate that the novel effect here described may impact on the immunosuppressive properties of glucocorticoids.
16949910 results suggest that suppressed ANXA1 expression in breast tissue is correlated with breast cancer development and progression
16899607 The high ANXA1 expression is frequent in esophageal and esophagogastric junction adenocarcinomas, correlates with more advanced pathologic T stage and the presence of distant metastasis, and is an independent prognostic factor for patient survival.
16883066 glucocorticoids and IL-1beta upregulate the synthesis and translocation of annexin I in rheumatoid synovial cells, but interdependent signalling pathways are involved
16741918 Annexin I may have tumor suppressor functions in prostate cancer. The pro-apoptotic effect of ANX I involves the activation of p38 and JNK, which appears to shift the balance of signal transduction away from proliferation and toward apoptosis.
16675446 AnxA1 has a role in stimulating SKCO-15 cell migration through nFPR activation
16627980 ANXA1 expression may correlate with the tumorigenesis suggesting that the protein may represent an effective differentiation marker in thyroid cancer.
16530434 ANXA1 and Gal-3 changed in their content and localization when neutrophils adhere to endothelia. In contrast, a decrease in the total amounts of Gal-1 was detected in migrated compared to non-migrated neutrophils.
16460738 gene expression of CCR10 was increased by recombinant ANXA1 and the N-terminal ANXA1 peptide
16324197 ANXA1 expression is decreased in prostatic adenocarcinoma and in high-grade prostatic intraepithelial neoplasia.
16100712 annexin A1 and A2 may have roles in dysferlin deficiency and in muscular dystrophies
16014420 These results suggest that annexin A1 may be a key protein involved in CF pathogenesis especially in relation to the not well defined field of inflammation in CF.
15944914 Results show that progression from prostatic intraepithelial neoplasia to prostate cancer is characterized by a reduction of ANX1 and suggest that downregulation of this protein could represent an important event in prostate carcinogenesis.
15883023 annexin1 exerted its erythropoiesis regulating effect by ERK pathway
15526283 Human colon adenocarcinoma cell differentiation is associated with an up-regulation of AnxA1, AnxA2, and AnxA5 and with a subcellular relocation of these proteins
15476183 Data show that there is no association of these SNPs in ANXA1 gene with type 2 diabetes in Shanghai Han population.
15476183 Observational study of gene-disease association. (HuGE Navigator)
15447985 annexin I is not the tumor suppressor gene corresponding to the high levels of loss of heterozygosity observed on chromosome 9 in esophageal squamous cell carcinoma
15187149 an annexin 1 peptide can activate FPR, FPRL1, and FPRL2; results indicate that annexin 1 participates in regulating leukocyte emigration into inflamed tissue by activating and desensitizing different receptors of the FPR family.
15168732 Annexin I was expressed in vivo in lungs containing metastasized MDA-MB-435 cells but not in normal lung tissue of athymic mice, suggesting that it is an important cellular protein that is down regulated through BRMS1 mediated metastasis suppression.
15157173 ANXA1 has roles in neutrophil apoptosis [review]
15064349 annexin II serves as both ligand and receptor in promoting phagocytosis.
14733945 Annexin-I has a role in drug resistance in tumor cells
14633604 The gene expression profile of ALD is dominated by alcohol metabolism and inflammation and differs from other liver diseases. Annexins may play a role in the progression of fibrosis in ALD.
12859969 These results showed that annexin I binds to a surface receptor in order to regulate the stimulation of insulin release in MIN6N8a cells.
12679902 This protein is translocated from cellular membrane to the nuclear membrane in human esophageal squamous cell carcinoma.
12236584 ANXA1 secretion in lymphocytes is unlikely to involve the classical ER-Golgi pathway; requires a Ca(2+)-dependent cleavage of ANXA1; involves both Ca(2+)-dependent and independent mechanisms; and is apparently independent of the GC receptor alpha isoform
12165536 interferes with a leukocyte endothelial step essential for U937 cell, and possibly monocyte, transmigration both in vitro and in vivo
11759108 17beta-estradiol promotes the synthesis and the secretion of annexin I in the CCRF-CEM human cell line.
11574426 Observational study of gene-disease association. (HuGE Navigator)
11468004 ANXA1-derived peptides inhibit antigen-driven cellular proliferation and cytokine production in vitro.

AA Sequence

MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILT      1 - 70
KRNNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEI     71 - 140
LASRTNKEIRDINRVYREELKRDLAKDITSDTSGDFRNALLSLAKGDRSEDFGVNEDLADSDARALYEAG    141 - 210
ERRKGTDVNVFNTILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAE    211 - 280
KLHQAMKGVGTRHKALIRIMVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILVALCGGN        281 - 346
//

Text Mined References (235)

PMID Year Title
27012521 2016 A novel anti-inflammatory mechanism of high density lipoprotein through up-regulating annexin A1 in vascular endothelial cells.
26885535 2016 Annexin A1 and the Resolution of Inflammation: Modulation of Neutrophil Recruitment, Apoptosis, and Clearance.
26803520 2016 The role of the Annexin-A1/FPR2 system in the regulation of mast cell degranulation provoked by compound 48/80 and in the inhibitory action of nedocromil.
26398190 2015 Annexin A1 Is Increased in the Plasma of Preeclamptic Women.
26369530 2016 Cysteine-rich secretory protein 3 plays a role in prostate cancer cell invasion and affects expression of PSA and ANXA1.
26312765 2015 Annexin A1 is involved in the acquisition and maintenance of a stem cell-like/aggressive phenotype in prostate cancer cells with acquired resistance to zoledronic acid.
26137966 2015 Annexin A1 expression in a pooled breast cancer series: association with tumor subtypes and prognosis.
26135980 2015 Brain microvascular endothelium induced-annexin A1 secretion contributes to small cell lung cancer brain metastasis.
26072160 2015 ANXA1Ac???? peptide reduces ID1 expression in cervical carcinoma cultures.
26000884 2015 Annexin A1 Preferentially Predicts Poor Prognosis of Basal-Like Breast Cancer Patients by Activating mTOR-S6 Signaling.
25983101 ANXA1 silencing increases the sensitivity of cancer cells to low-concentration arsenic trioxide treatment by inhibiting ERK MAPK activation.
25899628 2015 Annexin A1 negatively regulates viral RNA replication of hepatitis C virus.
25866182 2015 Annexin-A1 controls an ERK-RhoA-NF?B activation loop in breast cancer cells.
25854353 2015 Identification of ANXA1 as a lymphatic metastasis and poor prognostic factor in pancreatic ductal adenocarcinoma.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25664854 2015 Annexin A1-containing extracellular vesicles and polymeric nanoparticles promote epithelial wound repair.
25592491 2015 Upregulated Annexin A1 promotes cellular invasion in triple-negative breast cancer.
25536365 2014 Annexin-A1 regulates microRNA-26b* and microRNA-562 to directly target NF-?B and angiogenesis in breast cancer cells.
25510623 2014 Role of intracellular and extracellular annexin A1 in migration and invasion of human pancreatic carcinoma cells.
25490767 2014 Inflammation and cancer: role of annexin A1 and FPR2/ALX in proliferation and metastasis in human laryngeal squamous cell carcinoma.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25460034 2015 Cardioprotective potential of annexin-A1 mimetics in myocardial infarction.
25412936 2014 Increased expression of annexin A1 predicts poor prognosis in human hepatocellular carcinoma and enhances cell malignant phenotype.
25362540 2014 Characterization of pro-invasive mechanisms and N-terminal cleavage of ANXA1 in melanoma.
25344217 2015 Investigation of circulating antibodies to ANXA1 in breast cancer.
25337195 2014 Correlation of ANXA1 expression with drug resistance and relapse in bladder cancer.
25322804 2014 Expression of the Annexin A1 gene is associated with suppression of growth, invasion and metastasis of nasopharyngeal carcinoma.
25300907 2014 Co-overexpression of Hsp90-? and annexin A1 with a significantly positive correlation contributes to the diagnosis of lung cancer.
25201101 2015 The intricate role of mast cell proteases and the annexin A1-FPR1 system in abdominal wall endometriosis.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25038797 2014 Differential expression of ANXA1 in benign human gastrointestinal tissues and cancers.
25031270 2014 An annexin A1-FPR1 interaction contributes to necroptosis of keratinocytes in severe cutaneous adverse drug reactions.
25028131 2014 Dynamic dialog between cytokeratin 18 and annexin A1 in breast cancer: a transcriptional disequilibrium.
24810927 2014 Overexpression of ANXA1 confers independent negative prognostic impact in rectal cancers receiving concurrent chemoradiotherapy.
24790181 2014 Glomerular autoimmune multicomponents of human lupus nephritis in vivo: ?-enolase and annexin AI.
24719523 2014 Deregulation of annexin-A1 and galectin-1 expression in precancerous gastric lesions: intestinal metaplasia and gastric ulcer.
24591769 2014 Urine annexin A1 as an index for glomerular injury in patients.
24551299 2014 Association of nuclear annexin A1 with prognosis of patients with esophageal squamous cell carcinoma.
24525704 2014 Decreased levels of lipoxin A4 and annexin A1 in wheezy infants.
24480285 2014 Proteomic analysis of osteoarthritic chondrocyte reveals the hyaluronic acid-regulated proteins involved in chondroprotective effect under oxidative stress.
24464914 2014 CAF-secreted annexin A1 induces prostate cancer cells to gain stem cell-like features.
24300781 2014 The association of anti-annexin1 antibodies with the occurrence of skin lesions in systemic lupus erythematosus.
24282368 2013 Identification of Annexin A1 protein expression in human gastric adenocarcinoma using proteomics and tissue microarray.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24242295 2014 Annexin A1 in malignant tumors: current opinions and controversies.
24189400 2013 Perturbation of the mutated EGFR interactome identifies vulnerabilities and resistance mechanisms.
24156336 2013 Potential role of Anxa1 in cancer.
24130820 2013 Dysregulation of anti-inflammatory annexin A1 expression in progressive Crohns Disease.
24118254 2013 Annexin A1 complex mediates oxytocin vesicle transport.
23991102 2013 FoxM1 promotes glioma cells progression by up-regulating Anxa1 expression.
23958797 2013 Annexin A1: potential for glucocorticoid sparing in RA.
23786757 2013 Low Annexin A1 expression predicts benefit from induction chemotherapy in oral cancer patients with moderate or poor pathologic differentiation grade.
23754495 2013 Identification of Annexin A1 interacting proteins in chronic myeloid leukemia KCL22 cells.
23727357 2013 Annexin A1 is regulated by domains cross-talk through post-translational phosphorylation and SUMOYlation.
23674846 2013 Annexin A1: A new immunohistological marker of cholangiocarcinoma.
23638088 2013 Annexin A1 on the surface of early apoptotic cells suppresses CD8+ T cell immunity.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23431236 2013 Expression of annexin-A1 and galectin-1 anti-inflammatory proteins and mRNA in chronic gastritis and gastric cancer.
23413360 2013 Annexin A1 is a biomarker of T-tubular repair in skeletal muscle of nonmyopathic patients undergoing statin therapy.
23403091 2013 Annexin A1 down-regulation in oral squamous cell carcinoma correlates to pathological differentiation grade.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23376147 2013 Down-regulation of annexin A1 in the urothelium decreases cell survival after bacterial toxin exposure.
23341933 2013 Overexpression of ANXA1 in penile carcinomas positive for high-risk HPVs.
23277546 2013 Identification of an essential endogenous regulator of blood-brain barrier integrity, and its pathological and therapeutic implications.
23267026 2013 Deficiency of annexin A1 in CD4+ T cells exacerbates T cell-dependent inflammation.
23241962 2013 Annexin A1, formyl peptide receptor, and NOX1 orchestrate epithelial repair.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23154128 2013 Smooth muscle cells in human atherosclerosis: proteomic profiling reveals differences in expression of Annexin A1 and mitochondrial proteins in carotid disease.
23029153 2012 Annexin A1 N-terminal derived peptide Ac2-26 stimulates fibroblast migration in high glucose conditions.
23017499 2013 Annexin-A1 protein and its relationship to cortisol in human saliva.
22929401 2012 Upregulation of Hsp90-beta and annexin A1 correlates with poor survival and lymphatic metastasis in lung cancer patients.
22909323 2012 Quantitative proteomics reveal ATM kinase-dependent exchange in DNA damage response complexes.
22792315 2012 Annexin A1 and A2: roles in retrograde trafficking of Shiga toxin.
22777765 2013 Regulation of lung fibroblast activation by annexin A1.
22773844 2012 Annexin-1-mediated endothelial cell migration and angiogenesis are regulated by vascular endothelial growth factor (VEGF)-induced inhibition of miR-196a expression.
22736399 2012 Annexin A1 is associated with gastric cancer survival and promotes gastric cancer cell invasiveness through the formyl peptide receptor/extracellular signal-regulated kinase/integrin beta-1-binding protein 1 pathway.
22723974 2012 Up-regulation of Annexin-A1 and lipoxin A(4) in individuals with ulcerative colitis may promote mucosal homeostasis.
22701020 2012 Endothelial microparticle uptake in target cells is annexin I/phosphatidylserine receptor dependent and prevents apoptosis.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22640735 2012 The role of annexin A1 in expression of matrix metalloproteinase-9 and invasion of breast cancer cells.
22613333 2012 [Hypoxia upregulates the expression of annexin A1 in lung adenocarcinoma a549 cells].
22610094 2012 Annexin A1 interaction with the FPR2/ALX receptor: identification of distinct domains and downstream associated signaling.
22378018 2012 Annexin A1 mediates the anti-inflammatory effects during the granulocytic differentiation process in all-trans retinoic acid-treated acute promyelocytic leukemic cells.
22164217 2011 Propofol inhibits the activation of p38 through up-regulating the expression of annexin A1 to exert its anti-inflammation effect.
22116825 2012 Cleavage of annexin A1 by ADAM10 during secondary necrosis generates a monocytic "find-me" signal.
22056994 2012 Suppression of MIP-2 or IL-8 production by annexins A1 and A4 during coculturing of macrophages with late apoptotic human peripheral blood neutrophils.
21957127 2012 Annexin A1 regulates neutrophil clearance by macrophages in the mouse bone marrow.
21903368 2012 Eurycomanone suppresses expression of lung cancer cell tumor markers, prohibitin, annexin 1 and endoplasmic reticulum protein 28.
21836070 2011 Activation of the annexin A1 pathway underlies the protective effects exerted by estrogen in polymorphonuclear leukocytes.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21420379 2011 Proteomics analysis of starved cells revealed Annexin A1 as an important regulator of autophagic degradation.
21412170 2011 Dysferlin, annexin A1, and mitsugumin 53 are upregulated in muscular dystrophy and localize to longitudinal tubules of the T-system with stretch.
21398608 2011 Evidence for an anti-inflammatory loop centered on polymorphonuclear leukocyte formyl peptide receptor 2/lipoxin A4 receptor and operative in the inflamed microvasculature.
21383699 2011 Annexin-1 interacts with NEMO and RIP1 to constitutively activate IKK complex and NF-?B: implication in breast cancer metastasis.
21365324 2011 Identification of annexin A1 as a proinvasive and prognostic factor for lung adenocarcinoma.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
21269460 2011 Initial characterization of the human central proteome.
21254404 2011 Annexin A1 released from apoptotic cells acts through formyl peptide receptors to dampen inflammatory monocyte activation via JAK/STAT/SOCS signalling.
21195640 2011 Annexin A1 expression in atherosclerotic carotid plaques and its relationship with plaque characteristics.
21132403 2012 Quantitative proteomic analysis identifying three annexins as lymph node metastasis-related proteins in lung adenocarcinoma.
21127395 2010 Increased expression of annexin A1 is correlated with K-ras mutation in colorectal cancer.
21122411 2010 [Expression of annexin A1 (ANXA1) and A2 (ANXA2) and its significance in benign and malignant lesions of gallbladder].
20970165 2011 Down-regulation of annexin A1 and A2 protein expression in intestinal-type sinonasal adenocarcinomas.
20962261 2010 Annexin A1: a central player in the anti-inflammatory and neuroprotective role of microglia.
20930115 2011 Annexin-1 signals mitogen-stimulated breast tumor cell proliferation by activation of the formyl peptide receptors (FPRs) 1 and 2.
20924191 2010 Annexin-1 downregulation is associated with clinical outcome in Chinese patients with hilar cholangiocarcinoma.
20872967 2010 Up-regulation of hnRNP A1, Ezrin, tubulin ?-2C and Annexin A1 in sentinel lymph nodes of colorectal cancer.
20821804 2010 Annexin A1 attenuates EMT and metastatic potential in breast cancer.
20713499 2010 Cross-disorder genomewide analysis of schizophrenia, bipolar disorder, and depression.
20679535 2010 A proinflammatory role for proteolytically cleaved annexin A1 in neutrophil transendothelial migration.
20665809 2010 Nuclear localization of annexin A1 correlates with advanced disease and peritoneal dissemination in patients with gastric carcinoma.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602103 2011 The role of annexins I, II and IV in tumor development, progression and metastasis of human penile squamous cell carcinomas.
20558817 2010 Antiallergic cromones inhibit neutrophil recruitment onto vascular endothelium via annexin-A1 mobilization.
20549082 Expression of genes that encode the annexin-1 and galectin-1 proteins in nasal polyposis and their modulation by glucocorticoid.
20398702 2010 Differential roles of Annexin A1 (ANXA1/lipocortin-1/lipomodulin) and thioredoxin binding protein-2 (TBP-2/VDUP1/TXNIP) in glucocorticoid signaling of HTLV-I-transformed T cells.
20359522 2010 Ubiquitination and SUMOylation of annexin A1 and helicase activity.
20353277 2010 Annexin A1 expression and its prognostic significance in human breast cancer.
20308542 2010 Annexin A1 regulates TGF-beta signaling and promotes metastasis formation of basal-like breast cancer cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20163912 2010 Annexin-1 protects MCF7 breast cancer cells against heat-induced growth arrest and DNA damage.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20061392 2010 Regulation of vascular endothelial growth factor-induced endothelial cell migration by LIM kinase 1-mediated phosphorylation of annexin 1.
20029029 2009 Regulation of epidermal growth factor receptor trafficking by lysine deacetylase HDAC6.
20025479 2010 Annexin-I overexpression is associated with tumour progression and independently predicts inferior disease-specific and metastasis-free survival in urinary bladder urothelial carcinoma.
20007579 2009 Cell surface externalization of annexin A1 as a failsafe mechanism preventing inflammatory responses during secondary necrosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19850308 2010 Enhanced neutrophil expression of annexin-1 in coronary artery disease.
19767728 2009 Comparative analysis of annexin-1 in neuroepithelial tumors shows altered expression with the grade of malignancy but is not associated with survival.
19625660 2009 Annexin A1 regulates hormone exocytosis through a mechanism involving actin reorganization.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19428102 2009 Identification of annexin 1 as a PU.1 target gene in leukemia cells.
19351789 2009 Loss of annexin A1 disrupts normal prostate glandular structure by inducing autocrine IL-6 signaling.
19289595 2009 Immunophenotypic analysis of CD103+ B-lymphoproliferative disorders: hairy cell leukemia and its mimics.
19208747 2009 Annexin-1 regulates growth arrest induced by high levels of estrogen in MCF-7 breast cancer cells.
19204938 2009 Identification of annexin A1 as a novel substrate for E6AP-mediated ubiquitylation.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
19104500 2009 Annexin A1 and glucocorticoids as effectors of the resolution of inflammation.
19101730 2009 Down-regulation of plasma membranous Annexin A1 protein expression in premalignant and malignant lesions of the oral cavity: correlation with epithelial differentiation.
19076685 2008 Annexin A1 subcellular expression in laryngeal squamous cell carcinoma.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18794547 2008 Occurrence of autoantibodies to annexin I, 14-3-3 theta and LAMR1 in prediagnostic lung cancer sera.
18776816 2008 Loss of annexin A1 expression in breast cancer progression.
18767904 2008 Hrs and SNX3 functions in sorting and membrane invagination within multivesicular bodies.
18706208 2008 Expression of Annexin-1 in patients with endometriosis.
18673418 2009 Decreased expression of Annexin A1 correlates with pathologic differentiation grade in oral squamous cell carcinoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18663355 2008 MicroRNA-196a targets annexin A1: a microRNA-mediated mechanism of annexin A1 downregulation in cancers.
18652761 Decreased expression of annexin A1 during the progression of cervical neoplasia.
18641677 2008 Annexin-A1: a pivotal regulator of the innate and adaptive immune systems.
18594025 2008 Annexin 1 mediates the rapid anti-inflammatory effects of neutrophil-derived microparticles.
18566442 2008 Identification of annexin 1 as a novel autoantigen in acute exacerbation of idiopathic pulmonary fibrosis.
18396684 2007 [Expression of annexin I in human pancreatic cancer and the influence of its down-regulation on biology of this cancer].
18297688 2008 Nuclear localization of annexin A1 is a prognostic factor in oral squamous cell carcinoma.
18164291 2008 Heterogeneity and timing of translocation and membrane-mediated assembly of different annexins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17994624 2007 Overexpression of annexin a1 induced by terephthalic acid calculi in rat bladder cancer.
17971499 2008 Attenuated translocation of group IVa phospholipase A2 and up-regulated annexin-1 synthesis by glucocorticoid blocks beta 2-integrin adhesion in neutrophils.
17932043 2007 Truncation of annexin A1 is a regulatory lever for linking epidermal growth factor signaling with cytosolic phospholipase A2 in normal and malignant squamous epithelial cells.
17873281 2007 The confluence-dependent interaction of cytosolic phospholipase A2-alpha with annexin A1 regulates endothelial cell prostaglandin E2 generation.
17681950 2007 Annexin 1 cleavage in activated neutrophils: a pivotal role for proteinase 3.
17626739 2007 [Epstein-Barr virus-encoded latent membrane protein 1 mediates serine-phosphorylation of annexin I by activating protein kinase C].
17372018 2007 Annexin-1 and peptide derivatives are released by apoptotic cells and stimulate phagocytosis of apoptotic neutrophils by macrophages.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17340616 2007 Annexin 1: differential expression in tumor and mast cells in human larynx cancer.
17317721 2007 Activation of the annexin 1 counter-regulatory circuit affords protection in the mouse brain microcirculation.
17215481 2007 Annexin 1: the new face of an old molecule.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17023068 2006 Proteolytic cleavage of annexin 1 by human leukocyte elastase.
17019707 2007 Annexin-I as a potential target for green tea extract induced actin remodeling.
17008549 2007 Annexin-1 modulates T-cell activation and differentiation.
16984915 2006 Requirement for annexin A1 in plasma membrane repair.
16973129 2006 Glucocorticoid upregulation of the annexin-A1 receptor in leukocytes.
16949910 2006 Decreased expression of annexin A1 is correlated with breast cancer development and progression as determined by a tissue microarray analysis.
16899607 2006 Expression of annexin A1 in esophageal and esophagogastric junction adenocarcinomas: association with poor outcome.
16883066 2006 Regulation of annexin I in rheumatoid synovial cells by glucocorticoids and interleukin-1.
16741918 2006 The impact of altered annexin I protein levels on apoptosis and signal transduction pathways in prostate cancer cells.
16675446 2006 Annexin I regulates SKCO-15 cell invasion by signaling through formyl peptide receptors.
16627980 2006 Annexin-1 downregulation in thyroid cancer correlates to the degree of tumor differentiation.
16530434 2006 Interaction of human neutrophils with endothelial cells regulates the expression of endogenous proteins annexin 1, galectin-1 and galectin-3.
16460738 2006 In vitro and in vivo studies on CCR10 regulation by Annexin A1.
16324197 2005 Decreased annexin I expression in prostatic adenocarcinoma and in high-grade prostatic intraepithelial neoplasia.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
16100712 2005 Mutation finding in patients with dysferlin deficiency and role of the dysferlin interacting proteins annexin A1 and A2 in muscular dystrophies.
16014420 2005 Down-regulation of the anti-inflammatory protein annexin A1 in cystic fibrosis knock-out mice and patients.
15944914 2005 Localization of annexins I, II, IV and VII in whole prostate sections from radical prostatectomy patients.
15883023 2005 Annexin1 regulates the erythroid differentiation through ERK signaling pathway.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15581623 2004 Specific association of annexin 1 with plasma membrane-resident and internalized EGF receptors mediated through the protein core domain.
15526283 2005 Differentiation of human colon adenocarcinoma cells alters the expression and intracellular localization of annexins A1, A2, and A5.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485879 2004 Phosphorylation of annexin I by TRPM7 channel-kinase.
15476183 2004 [Absence of evidence for the association of single nucleotide polymorphisms in Annexin A1 gene with type 2 diabetes in Chinese].
15447985 2004 Comprehensive characterization of annexin I alterations in esophageal squamous cell carcinoma.
15226301 2004 Identification and characterization of the acidic pH binding sites for growth regulatory ligands of low density lipoprotein receptor-related protein-1.
15187149 2004 An annexin 1 N-terminal peptide activates leukocytes by triggering different members of the formyl peptide receptor family.
15168732 2004 Identification of metastasis-associated proteins through protein analysis of metastatic MDA-MB-435 and metastasis-suppressed BRMS1 transfected-MDA-MB-435 cells.
15157173 2004 Annexin 1 and neutrophil apoptosis.
15064349 2004 Macrophage surface expression of annexins I and II in the phagocytosis of apoptotic lymphocytes.
14733945 2004 Annexin-I expression modulates drug resistance in tumor cells.
14633604 2003 Gene expression profiling of alcoholic liver disease in the baboon (Papio hamadryas) and human liver.
14506282 2003 Dysferlin interacts with annexins A1 and A2 and mediates sarcolemmal wound-healing.
12859969 2003 The surface receptor is involved in annexin I-stimulated insulin secretion in MIN6N8a cells.
12679902 2003 Translocation of annexin I from cellular membrane to the nuclear membrane in human esophageal squamous cell carcinoma.
12645011 2003 Subcellular localization of S100A11 (S100C) in LLC-PK1 renal cells: Calcium- and protein kinase c-dependent association of S100A11 with S100B and vimentin intermediate filaments.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12236584 2002 Dexamethasone induces the secretion of annexin I in immature lymphoblastic cells by a calcium-dependent mechanism.
12165536 2002 Annexin 1 modulates monocyte-endothelial cell interaction in vitro and cell migration in vivo in the human SCID mouse transplantation model.
11574426 2001 Characterization of the annexin I gene and evaluation of its role in type 2 diabetes.
11468004 2001 An annexin 1 (ANXA1)-derived peptide inhibits prototype antigen-driven human T cell Th1 and Th2 responses in vitro.
10908733 2000 Small proline-rich protein 1 is the major component of the cell envelope of normal human oral keratinocytes.
10882119 2000 A novel ligand of the formyl peptide receptor: annexin I regulates neutrophil extravasation by interacting with the FPR.
10772777 2000 Annexin I is stored within gelatinase granules of human neutrophil and mobilized on the cell surface upon adhesion but not phagocytosis.
10673436 2000 Structural basis of the Ca(2+)-dependent association between S100C (S100A11) and its target, the N-terminal part of annexin I.
10512675 1999 Identification of genes (SPON2 and C20orf2) differentially expressed between cancerous and noncancerous lung cells by mRNA differential display.
9915835 1999 NMR solution structure of domain 1 of human annexin I shows an autonomous folding unit.
9459484 1998 Lipocortin 1 co-associates with cytokeratins 8 and 18 in A549 cells via the N-terminal domain.
8955167 1996 Partial mediation of glucocorticoid antiproliferative effects by lipocortins.
8587144 1995 A BC200-derived element and Z-DNA as structural markers in annexin I genes: relevance to Alu evolution and annexin tetrad formation.
8557678 1996 Calcium-dependent binding of S100C to the N-terminal domain of annexin I.
8453382 1993 Crystal structure of human annexin I at 2.5 A resolution.
8425544 1993 Structural characterization of a biologically active human lipocortin 1 expressed in Escherichia coli.
3303336 1987 Characterization by tandem mass spectrometry of structural modifications in proteins.
3013422 1986 Two human 35 kd inhibitors of phospholipase A2 are related to substrates of pp60v-src and of the epidermal growth factor receptor/kinase.
2971450 1988 Diversity in the lipocortin/calpactin family.
2969496 1988 Chromosomal localization of the human genes for lipocortin I and lipocortin II.
2967291 1988 Cloning and expression of cDNA for human endonexin II, a Ca2+ and phospholipid binding protein.
2936963 1986 Cloning and expression of human lipocortin, a phospholipase A2 inhibitor with potential anti-inflammatory activity.
2532504 1989 A dimeric form of lipocortin-1 in human placenta.
2457390 1988 Location of sites in human lipocortin I that are phosphorylated by protein tyrosine kinases and protein kinases A and C.
2138016 1990 Characterization of Ca2(+)-dependent phospholipid binding, vesicle aggregation and membrane fusion by annexins.
1832554 1991 Correlation of gene and protein structure of rat and human lipocortin I.
1670773 1991 Calcium-induced intracellular cross-linking of lipocortin I by tissue transglutaminase in A431 cells. Augmentation by membrane phospholipids.