Property Summary

NCBI Gene PubMed Count 25
PubMed Score 11.20
PubTator Score 25.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.653 1.2e-03
Multiple myeloma 1.245 2.1e-04
osteosarcoma -1.649 4.4e-05
group 3 medulloblastoma 1.400 3.0e-03
atypical teratoid / rhabdoid tumor 1.400 1.7e-07
glioblastoma 1.300 7.1e-05
medulloblastoma, large-cell 1.300 1.4e-04
primitive neuroectodermal tumor 1.200 5.1e-05
juvenile dermatomyositis 1.119 4.0e-15
acute quadriplegic myopathy 1.592 2.1e-09
pancreatic ductal adenocarcinoma liver m... 1.146 1.5e-02
pediatric high grade glioma 1.100 2.7e-04
ovarian cancer -1.200 4.6e-05
dermatomyositis 1.500 1.3e-04

Pathway (1)

Gene RIF (9)

PMID Text
25483709 Caspase-3-resistant uncleavable form of acidic leucine-rich nuclear phosphoprotein 32B potentiates leukemic cell apoptosis.
24823948 ANP32B is a nuclear target of henipavirus M proteins.
22705300 this is the first demonstration that ANP32B expression was down-regulated during differentiation induction of leukemic cells by all-trans retinoic acid.
22174317 The interaction of Rev with ANP32B is decreased by the presence of RRE
20538007 the interaction of ANP32B with the core histones H3-H4 occurs on its concave side, and both the acidic and hydrophobic residues that compose the concave surface are critical for histone binding.
20015864 ANP32B is a direct substrate of caspase-3. It is cleaved at the sequence of Ala-Glu-Val-Asp, after Asp-163. The reduced expression of endogenous ANP32B by specific siRNA enhances caspase-3 activation & apoptosis induction by NSC606985 & etoposide.
19130553 The CK2 alpha' phosphorylates APRIL and therefore is responsible for the regulation of the nucleocytoplasmic translocation of CD83 mRNA.
18039846 recruitment of ANP32B onto the promoter region requires KLF5 and results in promoter region-specific histone incorporation and inhibition of histone acetylation by ANP32B
12522243 regulatory roles of oncoprotein ProT and tumor suppressor PHAP in apoptosis

AA Sequence

MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLE      1 - 70
LSENRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDLFNCEVTNLNDYRESVFKLLP     71 - 140
QLTYLDGYDREDQEAPDSDAEVDGVDEEEEDEEGEDEEDEDDEDGEEEEFDEEDDEDEDVEGDEDDDEVS    141 - 210
EEEEEFGLDEEDEDEDEDEEEEEGGKGEKRKRETDDEGEDD                                 211 - 251
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25483709 2015 Caspase-3-resistant uncleavable form of acidic leucine-rich nuclear phosphoprotein 32B potentiates leukemic cell apoptosis.
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
25416956 2014 A proteome-scale map of the human interactome network.
24823948 2014 ANP32B is a nuclear target of henipavirus M proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22705300 2012 Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B) contributes to retinoic acid-induced differentiation of leukemic cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20538007 2010 Solution structure of histone chaperone ANP32B: interaction with core histones H3-H4 through its acidic concave domain.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20015864 2010 Downregulation of ANP32B, a novel substrate of caspase-3, enhances caspase-3 activation and apoptosis induction in myeloid leukemic cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19130553 2009 Phosphorylation of the HuR ligand APRIL by casein kinase 2 regulates CD83 expression.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18039846 2008 Promoter region-specific histone incorporation by the novel histone chaperone ANP32B and DNA-binding factor KLF5.
17178712 2007 Analysis of nucleocytoplasmic trafficking of the HuR ligand APRIL and its influence on CD83 expression.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15895553 2005 The Anp32 family of proteins containing leucine-rich repeats.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12522243 2003 Distinctive roles of PHAP proteins and prothymosin-alpha in a death regulatory pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11729309 2001 Delineation of mRNA export pathways by the use of cell-permeable peptides.
11018049 2000 Protein ligands to HuR modulate its interaction with target mRNAs in vivo.
9473664 1998 Expression analysis and chromosomal mapping of a novel human gene, APRIL, encoding an acidic protein rich in leucines.
9285060 1997 Cloning and characterization of a new silver-stainable protein SSP29, a member of the LRR family.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.