Property Summary

NCBI Gene PubMed Count 56
PubMed Score 144.37
PubTator Score 82.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.725 2.8e-03
Multiple myeloma 1.545 1.3e-03
oligodendroglioma 1.300 1.4e-02
psoriasis -2.700 1.9e-05
osteosarcoma -1.506 7.0e-05
sonic hedgehog group medulloblastoma 1.800 2.1e-05
medulloblastoma, large-cell 1.300 5.4e-04
Breast cancer 2.400 2.6e-02
posterior fossa group B ependymoma 1.200 6.4e-06
subependymal giant cell astrocytoma -1.203 2.5e-02
ovarian cancer 2.000 1.3e-04
dermatomyositis 1.100 3.1e-04

Gene RIF (29)

PMID Text
26738596 ANP32A represents an essential host partner co-opted to support influenza virus replication and is a candidate host target for novel antivirals
26512887 Host-derived proteins pp32 and APRIL interact with a free form of influenza virus RNA-dependent RNA polymerase and preferentially upregulates viral RNA synthesis rather than cRNA synthesis.
26057796 High-resolution crystal structure of the leucine-rich repeat domain of the human tumour suppressor PP32A (ANP32A) has been reported.
25902505 conformational analysis of the C-terminal transition state of the leucine-rich repeat domain of PP32
23839903 Demonstrate that HPPCn attenuated oxidative injury and fibrosis induced by ethanol feeding and that the SphK1/S1P/S1PRs signalling pathway contributes to this protective effect.
22174317 The interaction of Rev with ANP32A is decreased by the presence of RRE
21325029 pp32 interacted with STAT1 and STAT2 in an IFNB-dependent manner.
21317927 MicroRNA-21 targets tumor suppressor genes ANP32A and SMARCA4.
21152064 Data provide evidence that the tumor suppressor function of pp32 can be attributed to its ability to disrupt HuR binding to target mRNAs encoding key proteins for cancer cell survival and drug efficacy.
20683644 The HPPCn expression might be involved in the development of hepatocellular carcinoma and could be served as a promising biomarker.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20558741 Sphingosine interaction with acidic leucine-rich nuclear phosphoprotein-32A (ANP32A) regulates PP2A activity and cyclooxygenase (COX)-2 expression in human endothelial cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19565487 ANP32A is involved in the pathogenesis of osteoarthritis of the hip.
19565487 Observational study of gene-disease association. (HuGE Navigator)
19121999 PHAPI/pp32 suppresses tumorigenesis by stimulating apoptosis.
18439902 PHAPI, CAS, and Hsp70 function together to accelerate nucleotide exchange on Apaf-1 and prevent inactive Apaf-1/cytochrome c aggregation.
18410380 Results describe the solution structure of the evolutionarily conserved N-terminal leucine-rich repeat (LRR) domain of Anp32a and model its interactions with other proteins.
17962813 These results identify pp32/PHAPI as regulator of the apoptosis response of cancer cells in vitro and in vivo, and as a predictor of survival following chemotherapy for advanced non-small-cell lung cancer.
17557114 LANP and ATAXN1 interact in E4F-mediated transcriptional repression.
17266954 Immunoblot detection revealed that the inhibitor I1PP2A is expressed throughout the brain, including the hippocampus, temporal cortex, parietal cortex, subcortical nuclei and brain stem.
16341127 pp32 plays a repressive role by inhibiting transcription and triggering apoptosis.
16169070 The ANP32A protein is characterizing as modulators of Wnt protein signaling of Axin-1.
16009334 We now show pp32 increases androgen receptor-mediated transcription and the retinoblastoma protein modulates this activity.
15247276 tyrosine phosphorylation of PHAPI is accompanied by the release of PP2A from association with PHAPI, allowing increased phosphatase activity of PP2A and consequent complete dephosphorylation of the ERK kinase, MEK1/2, by 10 min and of ERK1/2 by 60 min
15136563 Set/TAF-Ibeta and pp32 proteins have roles as transducers of chromatin signaling by integrating chromatin hypoacetylation and transcriptional repression
12807913 LANP could play a key role in neuronal development and/or neurodegeneration by its interactions with microtubule associated proteins
12522243 regulatory roles of oncoprotein ProT and tumor suppressor PHAP in apoptosis
11830591 Regulation of histone acetylation and transcription by nuclear protein pp32, a subunit of the INHAT complex.

AA Sequence

MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLE      1 - 70
LSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLP     71 - 140
QLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEED    141 - 210
EEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD                                   211 - 249
//

Text Mined References (65)

PMID Year Title
26738596 2016 Species difference in ANP32A underlies influenza A virus polymerase host restriction.
26512887 2015 pp32 and APRIL are host cell-derived regulators of influenza virus RNA synthesis from cRNA.
26057796 2015 High-resolution crystal structure of the leucine-rich repeat domain of the human tumour suppressor PP32A (ANP32A).
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25902505 2015 Highly polarized C-terminal transition state of the leucine-rich repeat domain of PP32 is governed by local stability.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23839903 2013 Hepatopoietin Cn reduces ethanol-induced hepatoxicity via sphingosine kinase 1 and sphingosine 1-phosphate receptors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21806989 2011 Mechanism of inhibition of PP2A activity and abnormal hyperphosphorylation of tau by I2(PP2A)/SET.
21642993 2011 Genome-wide association study identifies three new susceptibility loci for esophageal squamous-cell carcinoma in Chinese populations.
21325029 2011 pp32, an INHAT component, is a transcription machinery recruiter for maximal induction of IFN-stimulated genes.
21317927 2011 MicroRNA-21 targets tumor suppressor genes ANP32A and SMARCA4.
21269460 2011 Initial characterization of the human central proteome.
21152064 2010 pp32 (ANP32A) expression inhibits pancreatic cancer cell growth and induces gemcitabine resistance by disrupting HuR binding to mRNAs.
20683644 2010 Involvement of hepatopoietin Cn in the development of human hepatocellular carcinoma.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20558741 2010 Sphingosine interaction with acidic leucine-rich nuclear phosphoprotein-32A (ANP32A) regulates PP2A activity and cyclooxygenase (COX)-2 expression in human endothelial cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19565487 2009 Variation at the ANP32A gene is associated with risk of hip osteoarthritis in women.
19121999 2009 PHAPI/pp32 suppresses tumorigenesis by stimulating apoptosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18439902 2008 PHAPI, CAS, and Hsp70 promote apoptosome formation by preventing Apaf-1 aggregation and enhancing nucleotide exchange on Apaf-1.
18410380 2008 Structural bases for recognition of Anp32/LANP proteins.
17962813 2008 pp32/PHAPI determines the apoptosis response of non-small-cell lung cancer.
17567741 2007 The crystal structure of the tumor suppressor protein pp32 (Anp32a): structural insights into Anp32 family of proteins.
17557114 2007 The role of LANP and ataxin 1 in E4F-mediated transcriptional repression.
17266954 2007 A novel monoclonal antibody DC63 reveals that inhibitor 1 of protein phosphatase 2A is preferentially nuclearly localised in human brain.
16818237 2006 The exonuclease TREX1 is in the SET complex and acts in concert with NM23-H1 to degrade DNA during granzyme A-mediated cell death.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341127 2006 Tumor suppressor pp32 represses cell growth through inhibition of transcription by blocking acetylation and phosphorylation of histone H3 and initiating its proapoptotic activity.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16009334 2005 A pp32-retinoblastoma protein complex modulates androgen receptor-mediated transcription and associates with components of the splicing machinery.
15895553 2005 The Anp32 family of proteins containing leucine-rich repeats.
15642345 2005 Inhibitors of protein phosphatase-2A from human brain structures, immunocytological localization and activities towards dephosphorylation of the Alzheimer type hyperphosphorylated tau.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15247276 2004 Protein phosphatase 2A, a negative regulator of the ERK signaling pathway, is activated by tyrosine phosphorylation of putative HLA class II-associated protein I (PHAPI)/pp32 in response to the antiproliferative lectin, jacalin.
15136563 2004 A signaling role of histone-binding proteins and INHAT subunits pp32 and Set/TAF-Ibeta in integrating chromatin hypoacetylation and transcriptional repression.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12807913 2003 Mapmodulin/leucine-rich acidic nuclear protein binds the light chain of microtubule-associated protein 1B and modulates neuritogenesis.
12628186 2003 Tumor suppressor NM23-H1 is a granzyme A-activated DNase during CTL-mediated apoptosis, and the nucleosome assembly protein SET is its inhibitor.
12565890 2003 Centaurin-alpha 1 associates in vitro and in vivo with nucleolin.
12524539 2003 Cleaving the oxidative repair protein Ape1 enhances cell death mediated by granzyme A.
12522243 2003 Distinctive roles of PHAP proteins and prothymosin-alpha in a death regulatory pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11909973 2002 HMG2 interacts with the nucleosome assembly protein SET and is a target of the cytotoxic T-lymphocyte protease granzyme A.
11830591 2002 Regulation of histone acetylation and transcription by nuclear protein pp32, a subunit of the INHAT complex.
11729309 2001 Delineation of mRNA export pathways by the use of cell-permeable peptides.
11555662 2001 Granzyme A activates an endoplasmic reticulum-associated caspase-independent nuclease to induce single-stranded DNA nicks.
11360199 2001 Tumor suppression and potentiation by manipulation of pp32 expression.
11163245 2001 Regulation of histone acetylation and transcription by INHAT, a human cellular complex containing the set oncoprotein.
11018049 2000 Protein ligands to HuR modulate its interaction with target mRNAs in vivo.
10400610 1999 Identification of sequences required for inhibition of oncogene-mediated transformation by pp32.
10086381 1999 Modulation of oncogenic potential by alternative gene use in human prostate cancer.
9353121 1997 The cerebellar leucine-rich acidic nuclear protein interacts with ataxin-1.
9144194 1997 Mapmodulin: a possible modulator of the interaction of microtubule-associated proteins with microtubules.
9110174 1997 Large-scale concatenation cDNA sequencing.
8970164 1996 Structure of pp32, an acidic nuclear protein which inhibits oncogene-induced formation of transformed foci.
8679524 1996 Molecular identification of I1PP2A, a novel potent heat-stable inhibitor protein of protein phosphatase 2A.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8530098 1995 Localization of the gene encoding the putative human HLA class II associated protein (PHAPI) to chromosome 15q22.3-q23 by fluorescence in situ hybridization.
8192856 1994 Purification and characterization of two putative HLA class II associated proteins: PHAPI and PHAPII.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1655467 1991 A functional complex is formed in human T lymphocytes between the protein tyrosine phosphatase CD45, the protein tyrosine kinase p56lck and pp32, a possible common substrate.