Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.01
PubTator Score 3.22

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
26872154 Children with low 25-hydroxyvitamin D and TMEM16J rs7111432-AA or PKP3 rs10902158-GG polymorphisms were at increased risk for tuberculosis or death.
26317553 Suggest role for up-regulation of ANO9 in progression and metastasis of stage II and III colorectal carcinoma.
22223854 These results demonstrate a strong association of single-nucleotide polymorphisms in the PKP3-SIGIRR-TMEM16J gene region and tuberculosis in discovery and validation cohorts.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MQGEESLRILVEPEGDSFPLMEISTCETEASEQWDYVLVAQRHTQRDPRQARQQQFLEELRRKGFHIKVI      1 - 70
RDQKQVFFGIRADNSVFGLYRTLLLEPEGPAPHAELAAPTTIPVTTSLRIRIVNFVVMNNKTSAGETFED     71 - 140
LMKDGVFEARFPLHKGEGRLKKTWARWRHMFREQPVDEIRNYFGEKVALYFVWLGWYTYMLVPAALTGLL    141 - 210
VFLSGFSLFEASQISKEICEAHDILMCPLGDHSRRYQRLSETCTFAKLTHLFDNDGTVVFAIFMALWATV    211 - 280
FLEIWKRQRARVVLHWDLYVWDEEQEEMALQLINCPDYKLRPYQHSYLRSTVILVLTLLMICLMIGMAHV    281 - 350
LVVYRVLASALFSSSAVPFLEEQVTTAVVVTGALVHYVTIIIMTKINRCVALKLCDFEMPRTFSERESRF    351 - 420
TIRFFTLQFFTHFSSLIYIAFILGRINGHPGKSTRLAGLWKLEECHASGCMMDLFVQMAIIMGLKQTLSN    421 - 490
CVEYLVPWVTHKCRSLRASESGHLPRDPELRDWRRNYLLNPVNTFSLFDEFMEMMIQYGFTTIFVAAFPL    491 - 560
APLLALFSNLVEIRLDAIKMVWLQRRLVPRKAKDIGTWLQVLETIGVLAVIANGMVIAFTSEFIPRVVYK    561 - 630
YRYSPCLKEGNSTVDCLKGYVNHSLSVFHTKDFQDPDGIEGSENVTLCRYRDYRNPPDYNFSEQFWFLLA    631 - 700
IRLAFVILFEHVALCIKLIAAWFVPDIPQSVKNKVLEVKYQRLREKMWHGRQRLGGVGAGSRPPMPAHPT    701 - 770
PASIFSARSTDV                                                              771 - 782
//

Text Mined References (21)

PMID Year Title
26872154 2016 Low Vitamin-D Levels Combined with PKP3-SIGIRR-TMEM16J Host Variants Is Associated with Tuberculosis and Death in HIV-Infected and -Exposed Infants.
26317553 2015 Identification and characterization of ANO9 in stage II and III colorectal carcinoma.
24692353 2014 Structure and function of TMEM16 proteins (anoctamins).
22946059 2012 Anoctamins are a family of Ca2+-activated Cl- channels.
22302790 2012 The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age.
22223854 2012 Common polymorphisms in the PKP3-SIGIRR-TMEM16J gene region are associated with susceptibility to tuberculosis.
22178883 2011 CFTR and TMEM16A are separate but functionally related Cl- channels.
21984732 2012 The anoctamin family: TMEM16A and TMEM16B as calcium-activated chloride channels.
21642943 2011 Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?
21607626 2011 Anoctamins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20056604 2010 Expression and function of epithelial anoctamins.
19015192 2009 Anoctamin/TMEM16 family members are Ca2+-activated Cl- channels.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15202010 2004 Identification and characterization of human TP53I5 and mouse Tp53i5 genes in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9305847 1997 A model for p53-induced apoptosis.