Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.70
PubTator Score 16.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Prostate cancer 172 3.229 1.6

Expression

Gene RIF (7)

PMID Text
25808443 high level of NGEP expression could be associated with good prognosis in prostate cancer
23955683 NGEP protein is widely expressed in low-grade to high-grade prostate adenocarcinomas as well as benign prostate tissues, and the intensity of expression is inversely proportional to the level of malignancy.
19495750 NGEP is a potential target for T cell-mediated immunotherapy of prostate cancer.
18676855 NGEP is a glycoprotein with predicted glycosylation sites at N809 and N824. When these residues were converted to glutamine, glycosylation was abolished, confirming that the residues are extracellular
15761874 description of the novel prostate-restricted molecule D-TMPP widely expressed in prostate cancer tissues
15375614 Complete coding sequence of TMEM16G cDNA was determined by assembling 25 exons of TMEM16G gene
14981236 expressed only in prostate and prostate camcer is a promising target for the antibody-based therapies of prostate cancer

AA Sequence

MRMAATAWAGLQGPPLPTLCPAVRTGLYCRDQAHAERWAMTSETSSGSHCARSRMLRRRAQEEDSTVLID      1 - 70
VSPPEAEKRGSYGSTAHASEPGGQQAAACRAGSPAKPRIADFVLVWEEDLKLDRQQDSAARDRTDMHRTW     71 - 140
RETFLDNLRAAGLCVDQQDVQDGNTTVHYALLSASWAVLCYYAEDLRLKLPLQELPNQASNWSAGLLAWL    141 - 210
GIPNVLLEVVPDVPPEYYSCRFRVNKLPRFLGSDNQDTFFTSTKRHQILFEILAKTPYGHEKKNLLGIHQ    211 - 280
LLAEGVLSAAFPLHDGPFKTPPEGPQAPRLNQRQVLFQHWARWGKWNKYQPLDHVRRYFGEKVALYFAWL    281 - 350
GFYTGWLLPAAVVGTLVFLVGCFLVFSDIPTQELCGSKDSFEMCPLCLDCPFWLLSSACALAQAGRLFDH    351 - 420
GGTVFFSLFMALWAVLLLEYWKRKSATLAYRWDCSDYEDTEERPRPQFAASAPMTAPNPITGEDEPYFPE    421 - 490
RSRARRMLAGSVVIVVMVAVVVMCLVSIILYRAIMAIVVSRSGNTLLAAWASRIASLTGSVVNLVFILIL    491 - 560
SKIYVSLAHVLTRWEMHRTQTKFEDAFTLKVFIFQFVNFYSSPVYIAFFKGRFVGYPGNYHTLFGVRNEE    561 - 630
CAAGGCLIELAQELLVIMVGKQVINNMQEVLIPKLKGWWQKFRLRSKKRKAGASAGASQGPWEDDYELVP    631 - 700
CEGLFDEYLEMVLQFGFVTIFVAACPLAPLFALLNNWVEIRLDARKFVCEYRRPVAERAQDIGIWFHILA    701 - 770
GLTHLAVISNAFLLAFSSDFLPRAYYRWTRAHDLRGFLNFTLARAPSSFAAAHNRTCRYRAFRDDDGHYS    771 - 840
QTYWNLLAIRLAFVIVFEHVVFSVGRLLDLLVPDIPESVEIKVKREYYLAKQALAENEVLFGTNGTKDEQ    841 - 910
PEGSELSSHWTPFTVPKASQLQQ                                                   911 - 933
//

Text Mined References (22)

PMID Year Title
25808443 2015 Study of NGEP expression pattern in cancerous tissues provides novel insights into prognostic marker in prostate cancer.
24692353 2014 Structure and function of TMEM16 proteins (anoctamins).
23955683 2013 Reduced expression of NGEP is associated with high-grade prostate cancers: a tissue microarray analysis.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22946059 2012 Anoctamins are a family of Ca2+-activated Cl- channels.
22302790 2012 The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age.
22075693 2012 ANOs 3-7 in the anoctamin/Tmem16 Cl- channel family are intracellular proteins.
21984732 2012 The anoctamin family: TMEM16A and TMEM16B as calcium-activated chloride channels.
21642943 2011 Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?
21607626 2011 Anoctamins.
20056604 2010 Expression and function of epithelial anoctamins.
19495750 2010 New gene expressed in prostate: a potential target for T cell-mediated prostate cancer immunotherapy.
19015192 2009 Anoctamin/TMEM16 family members are Ca2+-activated Cl- channels.
18676855 2008 Topology of NGEP, a prostate-specific cell:cell junction protein widely expressed in many cancers of different grade level.
17308099 2007 NGEP, a prostate-specific plasma membrane protein that promotes the association of LNCaP cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15761874 2005 D-TMPP: a novel androgen-regulated gene preferentially expressed in prostate and prostate cancer that is the first characterized member of an eukaryotic gene family.
15375614 2004 Characterization of human TMEM16G gene in silico.
14981236 2004 NGEP, a gene encoding a membrane protein detected only in prostate cancer and normal prostate.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10613842 1999 Prediction of gene function by genome-scale expression analysis: prostate cancer-associated genes.