Property Summary

NCBI Gene PubMed Count 36
PubMed Score 319.19
PubTator Score 33.43

Knowledge Summary

Patent (1,847)

Expression

  Differential Expression (18)

Disease log2 FC p
active ulcerative colitis 2.954 2.8e-02
adult high grade glioma 1.800 4.8e-05
astrocytic glioma 1.400 2.6e-02
Astrocytoma, Pilocytic 2.500 3.3e-11
atypical teratoid / rhabdoid tumor 1.300 7.1e-05
ductal carcinoma in situ -1.200 1.1e-03
ependymoma 1.500 3.7e-10
glioblastoma 1.600 6.0e-08
invasive ductal carcinoma -1.800 1.6e-03
lung adenocarcinoma -1.200 6.7e-10
lung carcinoma -2.000 7.9e-15
oligodendroglioma 1.100 2.5e-09
osteosarcoma 1.135 5.9e-03
ovarian cancer -1.900 3.5e-08
pancreatic cancer 1.200 2.5e-03
pancreatic ductal adenocarcinoma liver m... -1.388 7.2e-03
sonic hedgehog group medulloblastoma 1.300 6.2e-04
subependymal giant cell astrocytoma 1.816 2.2e-02

Protein-protein Interaction (12)

Gene RIF (17)

AA Sequence

MKKMSRNVLLQMEEEEDDDDGDIVLENLGQTIVPDLGSLESQHDFRTPEFEEFNGKPDSLFFNDGQRRID      1 - 70
FVLVYEDESRKETNKKGTNEKQRRKRQAYESNLICHGLQLEATRSVLDDKLVFVKVHAPWEVLCTYAEIM     71 - 140
HIKLPLKPNDLKNRSSAFGTLNWFTKVLSVDESIIKPEQEFFTAPFEKNRMNDFYIVDRDAFFNPATRSR    141 - 210
IVYFILSRVKYQVINNVSKFGINRLVNSGIYKAAFPLHDCKFRRQSEDPSCPNERYLLYREWAHPRSIYK    211 - 280
KQPLDLIRKYYGEKIGIYFAWLGYYTQMLLLAAVVGVACFLYGYLNQDNCTWSKEVCHPDIGGKIIMCPQ    281 - 350
CDRLCPFWKLNITCESSKKLCIFDSFGTLVFAVFMGVWVTLFLEFWKRRQAELEYEWDTVELQQEEQARP    351 - 420
EYEARCTHVVINEITQEEERIPFTAWGKCIRITLCASAVFFWILLIIASVIGIIVYRLSVFIVFSAKLPK    421 - 490
NINGTDPIQKYLTPQTATSITASIISFIIIMILNTIYEKVAIMITNFELPRTQTDYENSLTMKMFLFQFV    491 - 560
NYYSSCFYIAFFKGKFVGYPGDPVYWLGKYRNEECDPGGCLLELTTQLTIIMGGKAIWNNIQEVLLPWIM    561 - 630
NLIGRFHRVSGSEKITPRWEQDYHLQPMGKLGLFYEYLEMIIQFGFVTLFVASFPLAPLLALVNNILEIR    631 - 700
VDAWKLTTQFRRLVPEKAQDIGAWQPIMQGIAILAVVTNAMIIAFTSDMIPRLVYYWSFSVPPYGDHTSY    701 - 770
TMEGYINNTLSIFKVADFKNKSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV    771 - 840
MEHVIYSVKFFISYAIPDVSKRTKSKIQREKYLTQKLLHENHLKDMTKNMGVIAERMIEAVDNNLRPKSE    841 - 910
//

Text Mined References (46)

PMID Year Title