Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.23
PubTator Score 4.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -2.000 7.0e-03
posterior fossa group B ependymoma -2.800 5.7e-12
oligodendroglioma -1.300 4.6e-02
glioblastoma -2.000 7.2e-03
medulloblastoma -2.200 1.6e-04
atypical teratoid / rhabdoid tumor -2.900 3.1e-05
medulloblastoma, large-cell -3.000 2.2e-06
primitive neuroectodermal tumor -2.500 3.7e-03
interstitial cystitis -2.900 1.3e-04
adult high grade glioma -2.100 2.4e-05
aldosterone-producing adenoma -1.447 3.3e-02
subependymal giant cell astrocytoma -2.124 5.9e-03
Breast cancer -1.200 4.6e-02
lung carcinoma 1.600 5.0e-07
Pick disease -1.600 1.6e-04
progressive supranuclear palsy -1.300 2.3e-02
ovarian cancer -1.300 1.2e-09
pituitary cancer 2.500 2.2e-03

AA Sequence

MEASSSGITNGKTKVFHPEGGVDLQGYQLDMQILPDGPKSDVDFSEILNAIQEMAKDVNILFDELEAVSS      1 - 70
PCKDDDSLLHPGNLTSTSDDASRLEAGGETVPERNKSNGLYFRDGKCRIDYILVYRKSNPQTEKREVFER     71 - 140
NIRAEGLQMEKESSLINSDIIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFR    141 - 210
RWLPKKPMRLDKETLPDLEENDCYTAPFSQQRIHHFIIHNKETFFNNATRSRIVHHILQRIKYEEGKNKI    211 - 280
GLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLY    281 - 350
FAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHSQVSKEVCQATDIIMCPVCDKYCPFMRLSDSCVYAKVTH    351 - 420
LFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKKERMNPISGKPE    421 - 490
PYQAFTDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFC    491 - 560
IIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLIN    561 - 630
RWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEHGPERKISFPQWEKDYN    631 - 700
LQPMNAYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIW    701 - 770
YGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSE    771 - 840
PESDGSEFSGTPLKYCRYRDYRDPPHSLVPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLP    841 - 910
KDLRDRMRREKYLIQEMMYEAELERLQKERKERKKNGKAHHNEWP                             911 - 955
//

Text Mined References (14)

PMID Year Title
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24692353 2014 Structure and function of TMEM16 proteins (anoctamins).
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
22946059 2012 Anoctamins are a family of Ca2+-activated Cl- channels.
22302790 2012 The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age.
21642943 2011 Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?
21607626 2011 Anoctamins.
19015192 2009 Anoctamin/TMEM16 family members are Ca2+-activated Cl- channels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15067359 2004 Identification and characterization of TMEM16E and TMEM16F genes in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12739008 2003 FLJ10261 gene, located within the CCND1-EMS1 locus on human chromosome 11q13, encodes the eight-transmembrane protein homologous to C12orf3, C11orf25 and FLJ34272 gene products.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.