Property Summary

NCBI Gene PubMed Count 22
PubMed Score 89.24
PubTator Score 45.50

Knowledge Summary

Patent (1,177)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Panic disorder 55 0.0 2.0
Disease Target Count Z-score Confidence
Tracheomalacia 13 3.116 1.6
Meningocele 8 3.025 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
medulloblastoma, large-cell 1.700 1.0e-03
lung cancer -1.900 5.7e-04
lung adenocarcinoma -1.600 2.3e-18
group 3 medulloblastoma 2.400 3.0e-05
lung carcinoma -1.400 3.0e-09
non-small cell lung carcinoma -1.700 7.3e-37

Gene RIF (11)

PMID Text
26862169 data revealed prominently increased autoantibody reactivity against the chloride-channel protein anoctamin 2 (ANO2) in multiple sclerosis cases compared with controls
25635880 Olfactory function impairment in Italian patients with type 3 von Willebrand disease with partial deletion of TMEM16B.
25489088 results reveal multidimensional regulation of TMEM16A/16B by preassociated apoCaM and introduce ChIMP as a versatile tool to probe the macromolecular complex and function of Ca(2+)-activated chloride channels
24928056 ANO2 is present in human myometrium.
23570556 The third intracellular loop of TMEM16B is the site involved in calcium ion sensitivity, whereas the C-terminal part affects the rate of transition between the open and the closed state of the channel.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19561302 Ano2 likely amplifies the odor-induced generator potential in olfactory sensory neuron cilia by sensing elevated calcium levels, permitting the outward flow of chloride ions from the cell.
19474308 This study suggested that TMEM16B to be a strong candidate for the long sought-after Ca(2+)-dependent chloride channel in the photoreceptor synapse.
19165232 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17371490 VWF and TMEM16B deletions may have a role in severe von Willebrand disease type 3
12739008 C12orf3, FLJ10261 (ORAOV2), C11orf25 and FLJ34272 constitute a family of eight-transmembrane proteins with N- and C-terminal tails facing the cytoplasm.

AA Sequence

MATPGPRDIPLLPGSPRRLSPQAGSRGGQGPKHGQQCLKMPGPRAPGLQGGSNRDPGQPCGGESTRSSSV      1 - 70
INNYLDANEPVSLEARLSRMHFHDSQRKVDYVLAYHYRKRGVHLAQGFPGHSLAIVSNGETGKEPHAGGP     71 - 140
GDIELGPLDALEEERKEQREEFEHNLMEAGLELEKDLENKSQGSIFVRIHAPWQVLAREAEFLKIKVPTK    141 - 210
KEMYEIKAGGSIAKKFSAALQKLSSHLQPRVPEHSNNKMKNLSYPFSREKMYLYNIQEKDTFFDNATRSR    211 - 280
IVHEILKRTACSRANNTMGINSLIANNIYEAAYPLHDGEYDSPEDDMNDRKLLYQEWARYGVFYKFQPID    281 - 350
LIRKYFGEKIGLYFAWLGLYTSFLIPSSVIGVIVFLYGCATIEEDIPSREMCDQQNAFTMCPLCDKSCDY    351 - 420
WNLSSACGTAQASHLFDNPATVFFSIFMALWATMFLENWKRLQMRLGYFWDLTGIEEEEERAQEHSRPEY    421 - 490
ETKVREKMLKESNQSAVQKLETNTTECGDEDDEDKLTWKDRFPGYLMNFASILFMIALTFSIVFGVIVYR    491 - 560
ITTAAALSLNKATRSNVRVTVTATAVIINLVVILILDEIYGAVAKWLTKIEVPKTEQTFEERLILKAFLL    561 - 630
KFVNAYSPIFYVAFFKGRFVGRPGSYVYVFDGYRMEECAPGGCLMELCIQLSIIMLGKQLIQNNIFEIGV    631 - 700
PKLKKLFRKLKDETEAGETDSAHSKHPEQWDLDYSLEPYTGLTPEYMEMIIQFGFVTLFVASFPLAPVFA    701 - 770
LLNNVIEVRLDAKKFVTELRRPDAVRTKDIGIWFDILSGIGKFSVISNAFVIAITSDFIPRLVYQYSYSH    771 - 840
NGTLHGFVNHTLSFFNVSQLKEGTQPENSQFDQEVQFCRFKDYREPPWAPNPYEFSKQYWFILSARLAFV    841 - 910
IIFQNLVMFLSVLVDWMIPDIPTDISDQIKKEKSLLVDFFLKEEHEKLKLMDEPALRSPGGGDRSRSRAA    911 - 980
SSAPSGQSQLGSMMSSGSQHTNV                                                   981 - 1003
//

Text Mined References (28)

PMID Year Title
26862169 2016 Anoctamin 2 identified as an autoimmune target in multiple sclerosis.
25635880 2015 Assessment of the olfactory function in Italian patients with type 3 von Willebrand disease caused by a homozygous 253 Kb deletion involving VWF and TMEM16B/ANO2.
25489088 2014 Preassociated apocalmodulin mediates Ca2+-dependent sensitization of activation and inactivation of TMEM16A/16B Ca2+-gated Cl- channels.
24928056 2014 Calcium-activated chloride channels anoctamin 1 and 2 promote murine uterine smooth muscle contractility.
24692353 2014 Structure and function of TMEM16 proteins (anoctamins).
23570556 2013 TMEM16A-TMEM16B chimaeras to investigate the structure-function relationship of calcium-activated chloride channels.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22302790 2012 The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age.
21984732 2012 The anoctamin family: TMEM16A and TMEM16B as calcium-activated chloride channels.
21890523 2012 Anoctamin 2/TMEM16B: a calcium-activated chloride channel in olfactory transduction.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21642943 2011 Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?
21607626 2011 Anoctamins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20056604 2010 Expression and function of epithelial anoctamins.
19561302 2009 ANO2 is the cilial calcium-activated chloride channel that may mediate olfactory amplification.
19474308 2009 TMEM16B, a novel protein with calcium-dependent chloride channel activity, associates with a presynaptic protein complex in photoreceptor terminals.
19165232 2009 Genome-wide association study of panic disorder in the Japanese population.
19015192 2009 Anoctamin/TMEM16 family members are Ca2+-activated Cl- channels.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17371490 2007 A common 253-kb deletion involving VWF and TMEM16B in German and Italian patients with severe von Willebrand disease type 3.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15067359 2004 Identification and characterization of TMEM16E and TMEM16F genes in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12739008 2003 FLJ10261 gene, located within the CCND1-EMS1 locus on human chromosome 11q13, encodes the eight-transmembrane protein homologous to C12orf3, C11orf25 and FLJ34272 gene products.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.