Property Summary

NCBI Gene PubMed Count 32
PubMed Score 23.11
PubTator Score 14.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.400 1.4e-04
aldosterone-producing adenoma -1.157 4.8e-02
astrocytic glioma -2.000 7.0e-03
Astrocytoma, Pilocytic -1.200 1.8e-03
atypical teratoid / rhabdoid tumor -1.300 1.6e-04
ependymoma -1.100 3.1e-02
glioblastoma -1.900 1.6e-04
group 3 medulloblastoma -1.900 1.1e-03
intraductal papillary-mucinous neoplasm ... -1.100 8.0e-03
lung carcinoma 2.200 4.0e-30
medulloblastoma, large-cell -1.200 6.1e-04
oligodendroglioma -1.300 2.6e-02
primitive neuroectodermal tumor -1.700 2.0e-02
subependymal giant cell astrocytoma -2.874 1.6e-02

 GO Function (1)

Gene RIF (19)

AA Sequence

MGKDQELLEAARTGNVALVEKLLSGRKGGILGGGSGPLPLSNLLSIWRGPNVNCTDSSGYTALHHAALNG      1 - 70
HKDIVLKLLQYEASTNVADNKGYFPIHLAAWKGDVEIVKILIHHGPSHSRVNEQNNENETALHCAAQYGH     71 - 140
SEVVAVLLEELTDPTIRNSKLETPLDLAALYGRLRVVKMIISAHPNLMSCNTRKHTPLHLAARNGHKAVV    141 - 210
QVLLEAGMDVSCQTEKGSALHEAALFGKVDVVRVLLETGIDANIKDSLGRTVLDILKEHPSQKSLQIATL    211 - 280
LQEYLEGVGRSTVLEEPVQEDATQETHISSPVESPSQKTKSETVTGELSKLLDEIKLCQEKDYSFEDLCH    281 - 350
TISDHYLDNLSKISEEELGKNGSQSVRTSSTINLSPGEVEEEDDDENTCGPSGLWEALTPCNGCRNLGFP    351 - 420
MLAQESYPKKRNYTMEIVPSASLDTFPSENENFLCDLMDTAVTKKPCSLEIARAPSPRTDNASEVAVTTP    421 - 490
GTSNHRNSSTGPTPDCSPPSPDTALKNIVKVIRPQPKQRTSIVSSLDFHRMNHNQEYFEINTSTGCTSFT    491 - 560
ASPPASPPTSSVGTTEVKNEGTNHTDDLSRQDDNDPPKEYDPGQFAGLLHGSSPACESPENPFHLYGKRE    561 - 630
QCEKGQDEVSLANSPLPFKQSPIENNSEPLVKKIKPKVVSRTIFHKKSNQLENHTIVGTRSTRSGSRNGD    631 - 700
QWVMNAGGFVERACTLGRIRSLPKALIDMHLSKSVSKSDSDLIAYPSNEKTSRVNWSESSTAEHSSKGNS    701 - 770
ERTPSFTSEWEEIDKIMSSIDVGINNELKEMNGETTRPRCPVQTVGQWLESIGLPQYENHLMANGFDNVQ    771 - 840
FMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAEWLDSIELGDYTKAFLINGY    841 - 910
TSMDLLKKIWEVELINVLKINLIGHRKRILASLGDRLHDDPPQKPPRSITLREPSGNHTPPQLSPSLSQS    911 - 980
TYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQMAQTGDWGEPSITLRPPNEATASTPVQYWQH    981 - 1050
HPEKLIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDAT   1051 - 1120
NKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLAL   1121 - 1190
QARKGGHSSTLPESFENKPSKPIPKPRVSIRKSVDLLHASHTGQEPSERHTEEALRKF               1191 - 1248
//

Text Mined References (36)

PMID Year Title