Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 2.1e-12

Synonym

Accession B4E2M5
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

 HCA RNA Cell Line (1)

AA Sequence

MDTTLRMVRTACQHRAPQISHKTGCSHISMHSPGGLTTTKMAGPLPRVSDSLFSAMELAKMSDMTKLHQA      1 - 70
VAAGDYSLVKKILKKGLCDPNYKDVDWNDRTPLHWAAIKGQMEVIRLLIEYGARPCLVTSVGWTPAHFAA     71 - 140
EAGHLNILKTLHALHAAIDAPDFFGDTPKRIAQIYGQKACVAFLEKAEPECQDHRCAAQQKGLPLDERDE    141 - 210
DWDAKKRELELSLPSLNQNMNKKNKKSRGPTRPSNTKGRRV                                 211 - 251
//

Text Mined References (3)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.