Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.1e-12

Synonym

Accession B4E2M5
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

 HCA RNA Cell Line (1)

AA Sequence

MDTTLRMVRTACQHRAPQISHKTGCSHISMHSPGGLTTTKMAGPLPRVSDSLFSAMELAKMSDMTKLHQA      1 - 70
VAAGDYSLVKKILKKGLCDPNYKDVDWNDRTPLHWAAIKGQMEVIRLLIEYGARPCLVTSVGWTPAHFAA     71 - 140
EAGHLNILKTLHALHAAIDAPDFFGDTPKRIAQIYGQKACVAFLEKAEPECQDHRCAAQQKGLPLDERDE    141 - 210
DWDAKKRELELSLPSLNQNMNKKNKKSRGPTRPSNTKGRRV                                 211 - 251
//

Text Mined References (3)

PMID Year Title