Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.67
PubTator Score 12.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 3.500 2.1e-07
psoriasis -1.400 1.7e-02
osteosarcoma -1.352 1.5e-02
glioblastoma -1.600 2.1e-03
medulloblastoma, large-cell -3.200 3.8e-04
intraductal papillary-mucinous carcinoma... -1.600 1.4e-02
Breast cancer 2.900 2.5e-02
group 4 medulloblastoma -1.900 3.9e-03
spina bifida -1.426 3.9e-02
ovarian cancer 2.300 2.0e-04
pituitary cancer 1.400 1.3e-04

Gene RIF (6)

PMID Text
25200652 missense mutations in ANKRD6 are associated with neural tube defects.
24858714 study demonstrated that diversin was overexpressed in human breast cancers. Diversin could contribute to breast cancer cell proliferation and invasion.
24833088 diversin is overexpressed in human glioma and regulates glioma cell proliferation and invasion, possibly through MMP9
22580979 ANKRD6 genetic variants were associated with the muscle size and strength response to resistance training and habitual physical activity levels.
19591803 Diversin, containing several nuclear localization signals, translocates to the nucleus, where it interacts with the transcription factor AF9.
18187620 Knockdown of ankyrin repeat domain 6 (ANKRD6) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MSQQDAVAALSERLLVAAYKGQTENVVQLINKGARVAVTKHGRTPLHLAANKGHLPVVQILLKAGCDLDV      1 - 70
QDDGDQTALHRATVVGNTEIIAALIHEGCALDRQDKDGNTALHEASWHGFSQSAKLLIKAGANVLAKNKA     71 - 140
GNTALHLACQNSHSQSTRVLLLAGSRADLKNNAGDTCLHVAARYNHLSIIRLLLTAFCSVHEKNQAGDTA    141 - 210
LHVAAALNHKKVAKILLEAGADTTIVNNAGQTPLETARYHNNPEVALLLTKAPQVLRFSRGRSLRKKRER    211 - 280
LKEERRAQSVPRDEVAQSKGSVSAGDTPSSEQAVARKEEAREEFLSASPEPRAKDDRRRKSRPKVSAFSD    281 - 350
PTPPADQQPGHQKNLHAHNHPKKRNRHRCSSPPPPHEFRAYQLYTLYRGKDGKVMQAPINGCRCEPLINK    351 - 420
LENQLEATVEEIKAELGSVQDKMNTKLGQMENKTQHQMRVLDKLMVERLSAERTECLNRLQQHSDTEKHE    421 - 490
GEKRQISLVDELKTWCMLKIQNLEQKLSGDSRACRAKSTPSTCESSTGVDQLVVTAGPAAASDSSPPVVR    491 - 560
PKEKALNSTATQRLQQELSSSDCTGSRLRNVKVQTALLPMNEAARSDQQAGPCVNRGTQTKKSGKSGPTR    561 - 630
HRAQQPAASSTCGQPPPATGSEQTGPHIRDTSQALELTQYFFEAVSTQMEKWYERKIEEARSQANQKAQQ    631 - 700
DKATLKEHIKSLEEELAKLRTRVQKEN                                               701 - 727
//

Text Mined References (19)

PMID Year Title
25218921 2014 Ankrd6 is a mammalian functional homolog of Drosophila planar cell polarity gene diego and regulates coordinated cellular orientation in the mouse inner ear.
25200652 2015 Genetic studies of ANKRD6 as a molecular switch between Wnt signaling pathways in human neural tube defects.
24858714 2014 Diversin is overexpressed in breast cancer and accelerates cell proliferation and invasion.
24833088 2014 Diversin is overexpressed in human gliomas and its depletion inhibits proliferation and invasion.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
22580979 2012 Variants of the ankyrin repeat domain 6 gene (ANKRD6) and muscle and physical activity phenotypes among European-derived American adults.
21810271 2011 Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
19591803 2009 The planar cell polarity (PCP) protein Diversin translocates to the nucleus to interact with the transcription factor AF9.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17592114 2007 Csrp1 regulates dynamic cell movements of the mesendoderm and cardiac mesoderm through interactions with Dishevelled and Diversin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12203740 2002 Expression of the ankyrin repeat domain 6 gene (Ankrd6) during mouse brain development.
12183362 2002 The ankyrin repeat protein Diversin recruits Casein kinase Iepsilon to the beta-catenin degradation complex and acts in both canonical Wnt and Wnt/JNK signaling.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.