Property Summary

NCBI Gene PubMed Count 12
PubMed Score 17.47
PubTator Score 2.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.200 4.8e-03
hepatocellular carcinoma 1.500 1.4e-05
pancreatic cancer 1.100 2.1e-02
osteosarcoma 1.625 6.9e-03
glioblastoma -1.900 6.9e-03
astrocytoma -1.100 9.2e-03
atypical teratoid / rhabdoid tumor -1.500 4.0e-04
tuberculosis and treatment for 6 months -1.800 2.3e-05
pediatric high grade glioma -1.400 2.0e-04
pancreatic carcinoma 1.100 2.1e-02
lung carcinoma 1.100 2.4e-14
ovarian cancer -1.200 2.1e-03

AA Sequence

MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGAD      1 - 70
LLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESLEEQEVKGFN     71 - 140
RGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFRTTWQEFVEDLGFWRVLLLIFVIALLSLGIA    141 - 210
YYRRTLRLGSFARQDRSRIQAI                                                    211 - 232
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22559327 2012 Identification of genes with a correlation between copy number and expression in gastric cancer.
21269460 2011 Initial characterization of the human central proteome.
21219636 2011 Knockdown of miR-21 in human breast cancer cell lines inhibits proliferation, in vitro migration and in vivo tumor growth.
21041692 2010 Identification of genomic predictors of atrioventricular conduction: using electronic medical records as a tool for genome science.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17176038 2006 Ankyrin repeat: a unique motif mediating protein-protein interactions.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15152081 2004 The ankyrin repeat as molecular architecture for protein recognition.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11297942 2001 Identification of altered gene expression in skeletal muscles from Duchenne muscular dystrophy patients.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.