Property Summary

NCBI Gene PubMed Count 4
PubMed Score 44.84
PubTator Score 19.93

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N9B4 Q49A49
Symbols SARP
PPP1R79

Gene

  Ortholog (1)

Species Source Disease
Chimp EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHWLLWHGADITHVTTRGWTASH      1 - 70
IAAIRGQDACVQALIMNGANLTAQDDRGCTPLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAF     71 - 140
HGRLGCLQLLVKWGCSIEDVDYNGNLPVHLAAMEGHLHCFKFLVSRMSSATQVLKAFNDNGENVLDLAQR    141 - 210
FFKQNILQFIQGAEYEGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQ    211 - 280
GHIECLQWLIKMGADSNITNKAGERPSDVAKRFAHLAAVKLLEELQKYDIDDENEIDENDVKYFIRHGVE    281 - 350
GSTDAKDDLCLSDLDKTDARRPSKNCRASWSMNDYVEKN                                   351 - 389
//

Text Mined References (4)

PMID Year Title