Property Summary

NCBI Gene PubMed Count 4
PubMed Score 44.84
PubTator Score 19.93

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MPGVANSGPSTSSRETANPCSRKKVHFGSIHDAVRAGDVKQLSEIVCLHWLLWHGADITHVTTRGWTASH      1 - 70
IAAIRGQDACVQALIMNGANLTAQDDRGCTPLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAF     71 - 140
HGRLGCLQLLVKWGCSIEDVDYNGNLPVHLAAMEGHLHCFKFLVSRMSSATQVLKAFNDNGENVLDLAQR    141 - 210
FFKQNILQFIQGAEYEGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQ    211 - 280
GHIECLQWLIKMGADSNITNKAGERPSDVAKRFAHLAAVKLLEELQKYDIDDENEIDENDVKYFIRHGVE    281 - 350
GSTDAKDDLCLSDLDKTDARRPSKNCRASWSMNDYVEKN                                   351 - 389
//

Text Mined References (4)

PMID Year Title