Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.91
PubTator Score 2.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
urothelial carcinoma -1.600 1.5e-02
astrocytic glioma -1.500 2.4e-02
oligodendroglioma -1.400 3.2e-02
glioblastoma -1.400 2.7e-03
medulloblastoma -1.400 7.2e-04
medulloblastoma, large-cell -1.300 2.5e-03
primitive neuroectodermal tumor -1.400 5.8e-03
fascioscapulohumeral muscular dystrophy 1.028 7.1e-05
tuberculosis -1.800 1.1e-05
active ulcerative colitis 1.494 2.4e-02
pilocytic astrocytoma -1.200 1.7e-03
subependymal giant cell astrocytoma -1.333 4.2e-02
nasopharyngeal carcinoma -1.100 2.4e-03
psoriasis -1.500 3.2e-10
Endometriosis -1.186 5.0e-02
spina bifida -1.516 2.9e-02
invasive ductal carcinoma 1.200 1.0e-02
pituitary cancer -1.500 1.1e-04

Synonym

Accession Q7Z713
Symbols Lrp2bp

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
19491311 ANKRD37 is a direct HIF-1 target that is highly induced in hypoxia.

AA Sequence

MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHK      1 - 70
AAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVL     71 - 140
RQKRSLGSVENTSGKRKC                                                        141 - 158
//

Text Mined References (5)

PMID Year Title
19491311 2009 An integrative genomics approach identifies Hypoxia Inducible Factor-1 (HIF-1)-target genes that form the core response to hypoxia.
15809689 2005 Molecular cloning and characterization of a novel human gene containing 4 ankyrin repeat domains.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.