Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -3.400 2.6e-06
astrocytic glioma -1.600 4.9e-03
Astrocytoma, Pilocytic -3.800 9.9e-12
atypical teratoid / rhabdoid tumor -4.100 1.3e-15
ependymoma -2.000 2.8e-03
glioblastoma -3.500 2.0e-14
group 3 medulloblastoma -3.900 1.4e-05
medulloblastoma, large-cell -3.800 2.4e-06
oligodendroglioma -1.900 1.9e-03
pituitary cancer 1.100 4.5e-02
primitive neuroectodermal tumor -4.300 8.0e-08
subependymal giant cell astrocytoma -1.291 2.6e-02

AA Sequence

MMDDDTELRTDGNSLLKAVWLGRLRLTRLLLEGGAYINESNDKGETALMVACITKHVDQQSISKSKMVKY      1 - 70
LLDNRADPNIQDKSGKTALIHACIRRAGGEVVSLLLENGADPSLEDRTGASALVYAINADDKDALKHLLD     71 - 140
ACKAKGKEVIIITTDKSSSGTKTTKQYLNVPPSPKVEDRHSPPLCASPSDIELKALGLDSPLTEKEDDFF    141 - 210
SLQAGHPSSCNTSKAVNEPGSPTRKVSNLKRARLPQLKRLQSEPWGLIAPSVLAASTRQDETHGASTDNE    211 - 280
VIKSISDISFPKRGPLSRTNSIDSKDPTLFHTVTEQVLKIPVSSAPASWKAAYEKGQAPHPRLARRGTLP    281 - 350
VDQEKCGMGPSGPSALKEPASLKWLENDLYDLDIQPGPDPPNSISLESGKGPLDRKKLNSSHLSLFHGSR    351 - 420
ESLDTVPSTSPSSARRRPPHLLERRGSGTLLLDRISHTRPGFLPPLNVNLNPPIPDIRSSSKPSCSLASG    421 - 490
LKSMVPVAPSSPKRVDLRSKKKLLRRHSMQIEQMKQLSDFEEIMT                             491 - 535
//

Text Mined References (2)

PMID Year Title