Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.900 2.1e-06
astrocytic glioma -1.200 2.1e-02
Astrocytoma, Pilocytic -1.700 1.3e-08
atypical teratoid / rhabdoid tumor -2.400 6.5e-09
ependymoma -1.600 7.3e-03
glioblastoma -2.100 1.4e-09
group 3 medulloblastoma -2.400 2.4e-06
medulloblastoma, large-cell -2.200 8.5e-05
oligodendroglioma -1.400 1.3e-02
primitive neuroectodermal tumor -2.500 2.0e-04
subependymal giant cell astrocytoma -1.851 3.3e-02

AA Sequence

MLHTEGHALLRAVGQGKLRLARLLLEGGAYVNEGDAQGETALMAACRARYDDPQNKARMVRYLLEQGADP      1 - 70
NIADRLGRTALMHACAGGGGAAVASLLLAHGADPSVRDHAGASALVHALDRGDRETLATLLDACKAKGTE     71 - 140
VIIITTDTSPSGTKKTRQYLNSPPSPGVEDPAPASPSPGFCTSPSEIQLQTAGGGGRGMLSPRAQEEEEK    141 - 210
RDVFEFPLPKPPDDPSPSEPLPKPPRHPPKPLKRLNSEPWGLVAPPQPVPPTEGRPGIERLTAEFNGLTL    211 - 280
TGRPRLSRRHSTEGPEDPPPWAEKVTSGGPLSRRNTAPEAQESGPPSGLRQKLSRMEPVELDTPGHLCPD    281 - 350
SPESSRLSLERRRYSASPLTLPPAGSAPSPRQSQESLPGAVSPLSGRRRSPGLLERRGSGTLLLDHISQT    351 - 420
RPGFLPPLNVSPHPPIPDIRPQPGGRAPSLPAPPYAGAPGSPRTKRKLVRRHSMQTEQIRLLGGFQSLGG    421 - 490
PGEPGR                                                                    491 - 496
//

Text Mined References (6)

PMID Year Title