Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.13
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.300 2.7e-02
Astrocytoma, Pilocytic -1.700 5.0e-05
atypical teratoid / rhabdoid tumor -1.400 1.7e-03
ependymoma -1.500 5.7e-09
fibroadenoma -1.300 1.5e-02
glioblastoma -1.300 1.2e-05
lung adenocarcinoma -1.100 3.0e-14
primitive neuroectodermal tumor -1.800 1.2e-03
psoriasis -1.400 5.8e-40
tuberculosis -1.200 8.4e-05

 Compartment GO Term (2)

AA Sequence

MVLLAGTGPEGGGARCMTPPPPSPPRGAQVEEDPADYEEFEDFSSLPDTRSIASDDSFYPFEDEEEHGVE      1 - 70
SAESVPEGVPESVPETATLLRAACANNVGLLRTLVRRGVSVEEAQETDRNGRTGLIVACYHGFVDTVVAL     71 - 140
AECPHVDVNWQDSEGNTALITAAQAGHAIITNYLLNYFPGLDLERRNAFGFTALMKAAMQGRTDCIRALM    141 - 210
LAGADVHARDPRRGMSPQEWATYTGRVDAVRLMQRLLERPCPEQFWEKYRPELPPPPEAARKPAGSKNCL    211 - 280
QRLTDCVLSVLTPRSVRGPEDGGVLDHMVRMTTSLYSPAVAIVCQTVCPESPPSVGKRRLAVQEILAARA    281 - 350
ARGPQAQEEDEVGGAGQRGRTGQEDADSREGSPRAGLPPALGSRGPAAPAPRKASLLPLQRLRRRSVRPG    351 - 420
VVVPRVRVSKAPAPTFQPERPARKGSTKDSGHLQIPKWRYKEAKEEKRKAEEAEKKRQAEAQKERRTAPW    421 - 490
KKRT                                                                      491 - 494
//

Text Mined References (2)

PMID Year Title