Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.33

Knowledge Summary

Patent

No data available

Synonym

Accession A7E2S9 B8ZZL7
Symbols ANKRD30BP3
NCRNA00164

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

 Compartment GO Term (0)

 HCA RNA Cell Line (3)

AA Sequence

MERLSAAPVKGQTGPERPSPFSQLVYTNNDSYVIHHGDLRKIHKAASRGQAWKLERMMKKTTMDLNIRDA      1 - 70
KKRTALYWACANGHAEVVTLLVDRKCQLDVLDGENRTILMKALQCQREACANILIDSGADPNIVDVYGNT     71 - 140
AVHYAVNSENLSVVAKLLSCGADIEVKNKAGHTPLLLAIRKRSEEIVEFLLTKNANANAVDKFKCVHQQL    141 - 210
LEYKQKISKNSQNSNPEGTSEGTPDEAAPLAERTPDTAESLVERTPDE                          211 - 258
//

Text Mined References (5)

PMID Year Title