Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A7E2S9 B8ZZL7
Symbols ANKRD30BP3
NCRNA00164

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (0)

 HCA RNA Cell Line (3)

AA Sequence

MERLSAAPVKGQTGPERPSPFSQLVYTNNDSYVIHHGDLRKIHKAASRGQAWKLERMMKKTTMDLNIRDA      1 - 70
KKRTALYWACANGHAEVVTLLVDRKCQLDVLDGENRTILMKALQCQREACANILIDSGADPNIVDVYGNT     71 - 140
AVHYAVNSENLSVVAKLLSCGADIEVKNKAGHTPLLLAIRKRSEEIVEFLLTKNANANAVDKFKCVHQQL    141 - 210
LEYKQKISKNSQNSNPEGTSEGTPDEAAPLAERTPDTAESLVERTPDE                          211 - 258
//

Text Mined References (5)

PMID Year Title
17114284 2006 Characterization of a cancer/testis (CT) antigen gene family capable of eliciting humoral response in cancer patients.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15197164 2004 A transcript finishing initiative for closing gaps in the human transcriptome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.