Property Summary

NCBI Gene PubMed Count 17
PubMed Score 19.49
PubTator Score 22.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 2.4e-04
invasive ductal carcinoma 2950 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Breast cancer 3098 3.615 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
invasive ductal carcinoma 2.700 2.2e-02
psoriasis -1.600 2.4e-04

Gene RIF (10)

PMID Text
26415367 Results revealed a significant difference in NY-BR-1 Ag expression between benign and malignant breast cancer patients
23731661 The exclusive expression of Cancer-testis antigens in tumor tissues as well as the frequent expression of NY-BR-1 could define new targets for specific breast cancer therapies.
18976975 Knockdown of ankyrin repeat domain 30A (ANKRD30A) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of ankyrin repeat domain 30A (ANKRD30A) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18041742 We identified estrogen-response element (ERE)-like sequences nearby the NY-BR-1 promoter region, suggesting that NY-BR-1 expression might be regulated through estrogen receptors.
17536312 testing demonstrates NY-BR-1 in a mostly focal fashion in the epithelia of ducts and acini of the mammary gland. In tumors, homogenous staining can be seen in almost all ductal carcinomas in situ and/or the intraductal component of invasive carcinomas.
17330232 The strong expression of NY-BR-1 in breast tumors, its cytoplasmic and membrane localization and accessibility to an ectopically applied antibody now suggest to pursue NY-BR-1 as a potential target for antibody-based therapies in breast cancer patients.
16675566 NY-BR-1 is a differentiation antigen of the breast, which is present in normal and tumorous mammary epithelium.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16335914 In this study we extended the expression analysis to various other normal and tumor tissues and found inconsistent expression of NY-BR-1 in normal prostate, but consistent NY-BR-1 mRNA expression in 32% of prostate cancers, but not in other tumor types

AA Sequence

MEEISAAAVKVVPGPERPSPFSQLVYTSNDSYIVHSGDLRKIHKAASRGQVRKLEKMTKRKKTINLNIQD      1 - 70
AQKRTALHWACVNGHEEVVTFLVDRKCQLDVLDGEHRTPLMKALQCHQEACANILIDSGADINLVDVYGN     71 - 140
TALHYAVYSEILSVVAKLLSHGAVIEVHNKASLTPLLLSITKRSEQIVEFLLIKNANANAVNKYKCTALM    141 - 210
LAVCHGSSEIVGMLLQQNVDVFAADICGVTAEHYAVTCGFHHIHEQIMEYIRKLSKNHQNTNPEGTSAGT    211 - 280
PDEAAPLAERTPDTAESLVEKTPDEAAPLVERTPDTAESLVEKTPDEAASLVEGTSDKIQCLEKATSGKF    281 - 350
EQSAEETPREITSPAKETSEKFTWPAKGRPRKIAWEKKEDTPREIMSPAKETSEKFTWAAKGRPRKIAWE    351 - 420
KKETPVKTGCVARVTSNKTKVLEKGRSKMIACPTKESSTKASANDQRFPSESKQEEDEEYSCDSRSLFES    421 - 490
SAKIQVCIPESIYQKVMEINREVEEPPKKPSAFKPAIEMQNSVPNKAFELKNEQTLRADPMFPPESKQKD    491 - 560
YEENSWDSESLCETVSQKDVCLPKATHQKEIDKINGKLEESPNKDGLLKATCGMKVSIPTKALELKDMQT    561 - 630
FKAEPPGKPSAFEPATEMQKSVPNKALELKNEQTLRADEILPSESKQKDYEENSWDTESLCETVSQKDVC    631 - 700
LPKAAHQKEIDKINGKLEGSPVKDGLLKANCGMKVSIPTKALELMDMQTFKAEPPEKPSAFEPAIEMQKS    701 - 770
VPNKALELKNEQTLRADEILPSESKQKDYEESSWDSESLCETVSQKDVCLPKATHQKEIDKINGKLEESP    771 - 840
DNDGFLKAPCRMKVSIPTKALELMDMQTFKAEPPEKPSAFEPAIEMQKSVPNKALELKNEQTLRADQMFP    841 - 910
SESKQKKVEENSWDSESLRETVSQKDVCVPKATHQKEMDKISGKLEDSTSLSKILDTVHSCERARELQKD    911 - 980
HCEQRTGKMEQMKKKFCVLKKKLSEAKEIKSQLENQKVKWEQELCSVRLTLNQEEEKRRNADILNEKIRE    981 - 1050
ELGRIEEQHRKELEVKQQLEQALRIQDIELKSVESNLNQVSHTHENENYLLHENCMLKKEIAMLKLEIAT   1051 - 1120
LKHQYQEKENKYFEDIKILKEKNAELQMTLKLKEESLTKRASQYSGQLKVLIAENTMLTSKLKEKQDKEI   1121 - 1190
LEAEIESHHPRLASAVQDHDQIVTSRKSQEPAFHIAGDACLQRKMNVDVSSTIYNNEVLHQPLSEAQRKS   1191 - 1260
KSLKINLNYAGDALRENTLVSEHAQRDQRETQCQMKEAEHMYQNEQDNVNKHTEQQESLDQKLFQLQSKN   1261 - 1330
MWLQQQLVHAHKKADNKSKITIDIHFLERKMQHHLLKEKNEEIFNYNNHLKNRIYQYEKEKAETENS      1331 - 1397
//

Text Mined References (19)

PMID Year Title
26415367 2015 NY-BR-1 Antigen Expression and anti-NY-BR-1 IgG in Egyptian Breast Cancer Patients: Clinicopathological and Prognostic Significance.
25134534 2014 Genome-wide association study identifies new susceptibility loci for epithelial ovarian cancer in Han Chinese women.
23731661 2013 Cancer testis antigens and NY-BR-1 expression in primary breast cancer: prognostic and therapeutic implications.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
19043545 2008 Genetics meets metabolomics: a genome-wide association study of metabolite profiles in human serum.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18041742 2008 Distinct expression patterns of the immunogenic differentiation antigen NY-BR-1 in normal breast, testis and their malignant counterparts.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17903294 2007 Genome-wide association and linkage analyses of hemostatic factors and hematological phenotypes in the Framingham Heart Study.
17536312 2007 NY-BR-1 is a differentiation antigen of the mammary gland.
17330232 2007 The differentiation antigen NY-BR-1 is a potential target for antibody-based therapies in breast cancer.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16675566 2006 Preferential nuclear and cytoplasmic NY-BR-1 protein expression in primary breast cancer and lymph node metastases.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16364570 2006 Duplication and extensive remodeling shaped POTE family genes encoding proteins containing ankyrin repeat and coiled coil domains.
16335914 2005 Humoral and cellular immune responses against the breast cancer antigen NY-BR-1: definition of two HLA-A2 restricted peptide epitopes.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
11280766 2001 Identification of a tissue-specific putative transcription factor in breast tissue by serological screening of a breast cancer library.