Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.64
PubTator Score 40.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.300 1.2e-04
aldosterone-producing adenoma -1.022 1.9e-02
Astrocytoma, Pilocytic 1.200 7.4e-03
atypical teratoid / rhabdoid tumor -1.400 2.3e-06
chronic rhinosinusitis -1.166 4.7e-02
glioblastoma -1.500 8.5e-05
hereditary spastic paraplegia -1.133 2.0e-02
intraductal papillary-mucinous neoplasm ... 1.300 2.4e-02
malignant mesothelioma 1.100 1.7e-06
medulloblastoma -1.300 9.3e-04
non primary Sjogren syndrome sicca -1.100 1.0e-02
non-small cell lung cancer -1.306 4.7e-18
ovarian cancer 1.200 4.2e-02
pancreatic ductal adenocarcinoma liver m... -1.292 2.1e-02
Pick disease 1.200 1.0e-03
Rheumatoid arthritis 3.200 3.2e-04
tuberculosis -1.100 4.8e-06
ulcerative colitis 1.600 2.3e-03

Protein-protein Interaction (1)

Gene RIF (5)

AA Sequence

MAFLKLRDQPSLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAK      1 - 70
DSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAG     71 - 140
RTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPL    141 - 210
HAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAA    211 - 280
ASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYG    281 - 350
HELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLEC    351 - 420
LNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEY    421 - 490
LLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYH    491 - 560
GHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHS    561 - 630
ECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEE    631 - 700
CVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHET    701 - 770
CVELLLEQEVFQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQ    771 - 840
LLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLIL    841 - 910
EKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALIL    911 - 980
ATMMPVSSSSPLSSLTFNAINRYTNTSKTVSFEALPIMRNEPSSYCSFNNIGGEQEYLYTDVDELNDSDS    981 - 1050
ETY                                                                      1051 - 1053
//

Text Mined References (24)

PMID Year Title