Property Summary

NCBI Gene PubMed Count 21
PubMed Score 13.59
PubTator Score 6.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.067 1.3e-02
malignant mesothelioma 1.200 2.2e-05
glioblastoma -1.100 5.0e-04
acute quadriplegic myopathy 1.044 6.6e-06
pancreatic ductal adenocarcinoma liver m... 1.067 1.6e-02
pediatric high grade glioma -1.100 4.1e-05
group 4 medulloblastoma -1.400 2.3e-05
ovarian cancer 1.700 9.4e-04
dermatomyositis 1.500 7.6e-04

Gene RIF (6)

PMID Text
25407941 Eosinophilic esophagitis was associate with increased expression of ANKRD27.
23104059 VAMP7-SNARE motif is trapped between Varp and the VAMP7 longin domain, and hence Varp kinetically inhibits the ability of VAMP7 to form SNARE complexes
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19745841 show that TI-VAMP interacts with the Vps9 domain and ankyrin-repeat-containing protein Varp, a guanine nucleotide exchange factor of the small GTPase Rab21, through a specific domain herein called the interacting domain.
18477474 Varp physically interacts with Rab38, and preferentially binds to the active GTP-bound form of Rab38 both in vitro and in vivo.

AA Sequence

MALYDEDLLKNPFYLALQKCRPDLCSKVAQIHGIVLVPCKGSLSSSIQSTCQFESYILIPVEEHFQTLNG      1 - 70
KDVFIQGNRIKLGAGFACLLSVPILFEETFYNEKEESFSILCIAHPLEKRESSEEPLAPSDPFSLKTIED     71 - 140
VREFLGRHSERFDRNIASFHRTFRECERKSLRHHIDSANALYTKCLQQLLRDSHLKMLAKQEAQMNLMKQ    141 - 210
AVEIYVHHEIYNLIFKYVGTMEASEDAAFNKITRSLQDLQQKDIGVKPEFSFNIPRAKRELAQLNKCTSP    211 - 280
QQKLVCLRKVVQLITQSPSQRVNLETMCADDLLSVLLYLLVKTEIPNWMANLSYIKNFRFSSLAKDELGY    281 - 350
CLTSFEAAIEYIRQGSLSAKPPESEGFGDRLFLKQRMSLLSQMTSSPTDCLFKHIASGNQKEVERLLSQE    351 - 420
DHDKDTVQKMCHPLCFCDDCEKLVSGRLNDPSVVTPFSRDDRGHTPLHVAAVCGQASLIDLLVSKGAMVN    421 - 490
ATDYHGATPLHLACQKGYQSVTLLLLHYKASAEVQDNNGNTPLHLACTYGHEDCVKALVYYDVESCRLDI    491 - 560
GNEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLKCALNSKILSVMEAYHLSFERRQKSSEA    561 - 630
PVQSPQRSVDSISQESSTSSFSSMSASSRQEETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAE    631 - 700
DTVSAADPEFCHPLCQCPKCAPAQKRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANA    701 - 770
GARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASINASN    771 - 840
NKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCVASLDDVAETD    841 - 910
RKEYVTVKIRKKWNSKLYDLPDEPFTRQFYFVHSAGQFKGKTSREIMARDRSVPNLTEGSLHEPGRQSVT    911 - 980
LRQNNLPAQSGSHAAEKGNSDWPERPGLTQTGPGHRRMLRRHTVEDAVVSQGPEAAGPLSTPQEVSASRS    981 - 1050
//

Text Mined References (26)

PMID Year Title
25407941 2014 GWAS identifies four novel eosinophilic esophagitis loci.
24856514 2014 VARP is recruited on to endosomes by direct interaction with retromer, where together they function in export to the cell surface.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23104059 2012 The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation.
22705394 2012 A molecular network for the transport of the TI-VAMP/VAMP7 vesicles from cell center to periphery.
21808068 2011 RUTBC1 protein, a Rab9A effector that activates GTP hydrolysis by Rab32 and Rab33B proteins.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19745841 2009 Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18477474 2008 Varp interacts with Rab38 and functions as its potential effector.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16525121 2006 Varp is a Rab21 guanine nucleotide exchange factor and regulates endosome dynamics.
16381901 2006 The LIFEdb database in 2006.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.