Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.40
PubTator Score 0.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
urothelial carcinoma -1.400 3.9e-02
astrocytic glioma 1.700 1.7e-02
ependymoma 1.300 4.4e-02
osteosarcoma -3.534 1.9e-06
glioblastoma 1.200 5.0e-04
tuberculosis 2.700 1.6e-02
non-small cell lung cancer 2.328 2.6e-16
intraductal papillary-mucinous adenoma (... 2.800 3.4e-04
intraductal papillary-mucinous carcinoma... 2.100 3.0e-03
intraductal papillary-mucinous neoplasm ... 2.200 1.3e-02
active Crohn's disease 1.131 5.5e-03
ulcerative colitis 1.700 5.1e-05
pancreatic cancer 2.200 3.1e-06
interstitial cystitis -1.900 8.9e-03
cystic fibrosis 1.900 1.6e-05
lung adenocarcinoma 2.400 7.0e-13
pediatric high grade glioma 1.500 2.5e-04
pilocytic astrocytoma 2.000 9.3e-06
primary Sjogren syndrome 1.100 2.1e-03
sarcoidosis 1.800 4.0e-05
subependymal giant cell astrocytoma 1.795 1.9e-02
nasopharyngeal carcinoma 1.300 9.6e-03
lung carcinoma -1.200 1.4e-04
breast carcinoma 1.400 6.5e-25
spina bifida -1.737 3.0e-02
Breast cancer 1.100 3.0e-03
mucosa-associated lymphoid tissue lympho... 1.595 3.0e-02
ductal carcinoma in situ 2.200 9.0e-03
invasive ductal carcinoma 2.800 2.1e-03
ovarian cancer 1.500 2.3e-08

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGILYSEPICQAAYQNDFGQVWRWVKEDSSYANVQDGFNGDTPLICACRRGHVRIVSFLLRRNANVNLKN      1 - 70
QKERTCLHYAVKKKFTFIDYLLIILLMPVLLIGYFLMVSKTKQNEALVRMLLDAGVEVNATDCYGCTALH     71 - 140
YACEMKNQSLIPLLLEARADPTIKNKHGESSLDIARRLKFSQIELMLRKAL                       141 - 191
//

Text Mined References (10)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.