Property Summary

NCBI Gene PubMed Count 29
PubMed Score 36.22
PubTator Score 18.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (14)

AA Sequence

MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDL      1 - 70
LVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEP     71 - 140
EEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQ    141 - 210
DRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREG    211 - 280
DTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSG    281 - 350
RETPQPVPAQ                                                                351 - 360
//

Text Mined References (29)

PMID Year Title