Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.26
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.74025817352555E-33
juvenile dermatomyositis 1189 7.12127427157567E-13
osteosarcoma 7933 7.26400391235656E-7
ovarian cancer 8492 2.74967097737108E-5
group 4 medulloblastoma 1875 8.70067294203775E-5
diabetes mellitus 1663 0.00152684550132057
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0032722448848166
pancreatic cancer 2300 0.00712365866490796
progressive supranuclear palsy 674 0.0123678822811407
non diabetic and post-ischemic heart failure 200 0.0289259580576425
spina bifida 1064 0.035817889435841

Expression

  Differential Expression (11)

Synonym

Accession Q8IZ07 O60736
Symbols ANKRD13
NY-REN-25

Gene

  Ortholog (10)

Pathway (1)

Gene RIF (5)

PMID Text
26797118 The Ankrd13 family of ubiquitin-interacting motif (UIM)-containing proteins are novel VCP-interacting molecules in the endosome.
26038114 We validated ANKRD13A as a novel constituent of BCR signalosome and showed that BCR-induced phosphorylation of RAB7A at S72 regulates its association with its effector proteins and with endo-lysosomal compartments.
23620728 the microRNA miR-204 promotes both mesenchymal neural crest and lens cell migration and elongation by the direct targeting of the Ankrd13A gene.
22298428 overexpression of wild-type as well as truncated-mutant Ankrd 13A, 13B and 13D proteins strongly inhibited rapid endocytosis of ubiquitinated EGFR from the surface in EGF-treated cells
22190034 HIV-1 Vpr is identified to have a physical interaction with ankyrin repeat domain 13A (ANKRD13A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MSSACDAGDHYPLHLLVWKNDYRQLEKELQGQNVEAVDPRGRTLLHLAVSLGHLESARVLLRHKADVTKE      1 - 70
NRQGWTVLHEAVSTGDPEMVYTVLQHRDYHNTSMALEGVPELLQKILEAPDFYVQMKWEFTSWVPLVSRI     71 - 140
CPNDVCRIWKSGAKLRVDITLLGFENMSWIRGRRSFIFKGEDNWAELMEVNHDDKVVTTERFDLSQEMER    141 - 210
LTLDLMKPKSREVERRLTSPVINTSLDTKNIAFERTKSGFWGWRTDKAEVVNGYEAKVYTVNNVNVITKI    211 - 280
RTEHLTEEEKKRYKADRNPLESLLGTVEHQFGAQGDLTTECATANNPTAITPDEYFNEEFDLKDRDIGRP    281 - 350
KELTIRTQKFKAMLWMCEEFPLSLVEQVIPIIDLMARTSAHFARLRDFIKLEFPPGFPVKIEIPLFHVLN    351 - 420
ARITFGNVNGCSTAEESVSQNVEGTQADSASHITNFEVDQSVFEIPESYYVQDNGRNVHLQDEDYEIMQF    421 - 490
AIQQSLLESSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLCPSALSETSRFDNDLQLAMEL    491 - 560
SAKELEEWELRLQEEEAELQQVLQLSLTDK                                            561 - 590
//

Text Mined References (12)

PMID Year Title
26797118 2016 The Ankrd13 Family of Ubiquitin-interacting Motif-bearing Proteins Regulates Valosin-containing Protein/p97 Protein-mediated Lysosomal Trafficking of Caveolin 1.
26038114 2015 Systems-wide analysis of BCR signalosomes and downstream phosphorylation and ubiquitylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23620728 2013 miR-204 targeting of Ankrd13A controls both mesenchymal neural crest and lens cell migration.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
22298428 2012 The Ankrd 13 family of UIM-bearing proteins regulates EGF receptor endocytosis from the plasma membrane.
21269460 2011 Initial characterization of the human central proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...