Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.26
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -2.137 7.3e-07
group 4 medulloblastoma 1.400 8.7e-05
non diabetic and post-ischemic heart fai... -1.400 2.9e-02
juvenile dermatomyositis 1.319 7.1e-13
intraductal papillary-mucinous neoplasm ... 1.400 3.3e-03
diabetes mellitus -1.300 1.5e-03
lung carcinoma -1.300 1.7e-33
spina bifida -1.399 3.6e-02
progressive supranuclear palsy -1.300 1.2e-02
ovarian cancer 1.600 2.7e-05
pancreatic cancer 1.100 7.1e-03

Gene RIF (5)

PMID Text
26797118 The Ankrd13 family of ubiquitin-interacting motif (UIM)-containing proteins are novel VCP-interacting molecules in the endosome.
26038114 We validated ANKRD13A as a novel constituent of BCR signalosome and showed that BCR-induced phosphorylation of RAB7A at S72 regulates its association with its effector proteins and with endo-lysosomal compartments.
23620728 the microRNA miR-204 promotes both mesenchymal neural crest and lens cell migration and elongation by the direct targeting of the Ankrd13A gene.
22298428 overexpression of wild-type as well as truncated-mutant Ankrd 13A, 13B and 13D proteins strongly inhibited rapid endocytosis of ubiquitinated EGFR from the surface in EGF-treated cells
22190034 HIV-1 Vpr is identified to have a physical interaction with ankyrin repeat domain 13A (ANKRD13A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MSSACDAGDHYPLHLLVWKNDYRQLEKELQGQNVEAVDPRGRTLLHLAVSLGHLESARVLLRHKADVTKE      1 - 70
NRQGWTVLHEAVSTGDPEMVYTVLQHRDYHNTSMALEGVPELLQKILEAPDFYVQMKWEFTSWVPLVSRI     71 - 140
CPNDVCRIWKSGAKLRVDITLLGFENMSWIRGRRSFIFKGEDNWAELMEVNHDDKVVTTERFDLSQEMER    141 - 210
LTLDLMKPKSREVERRLTSPVINTSLDTKNIAFERTKSGFWGWRTDKAEVVNGYEAKVYTVNNVNVITKI    211 - 280
RTEHLTEEEKKRYKADRNPLESLLGTVEHQFGAQGDLTTECATANNPTAITPDEYFNEEFDLKDRDIGRP    281 - 350
KELTIRTQKFKAMLWMCEEFPLSLVEQVIPIIDLMARTSAHFARLRDFIKLEFPPGFPVKIEIPLFHVLN    351 - 420
ARITFGNVNGCSTAEESVSQNVEGTQADSASHITNFEVDQSVFEIPESYYVQDNGRNVHLQDEDYEIMQF    421 - 490
AIQQSLLESSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLCPSALSETSRFDNDLQLAMEL    491 - 560
SAKELEEWELRLQEEEAELQQVLQLSLTDK                                            561 - 590
//

Text Mined References (12)

PMID Year Title
26797118 2016 The Ankrd13 Family of Ubiquitin-interacting Motif-bearing Proteins Regulates Valosin-containing Protein/p97 Protein-mediated Lysosomal Trafficking of Caveolin 1.
26038114 2015 Systems-wide analysis of BCR signalosomes and downstream phosphorylation and ubiquitylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23620728 2013 miR-204 targeting of Ankrd13A controls both mesenchymal neural crest and lens cell migration.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
22298428 2012 The Ankrd 13 family of UIM-bearing proteins regulates EGF receptor endocytosis from the plasma membrane.
21269460 2011 Initial characterization of the human central proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.