Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.484 3.7e-07
astrocytic glioma 1.400 1.4e-02
Astrocytoma, Pilocytic 1.200 2.1e-04
ependymoma 1.700 2.3e-02
glioblastoma 1.400 3.3e-02
group 3 medulloblastoma 1.200 2.4e-02
intraductal papillary-mucinous adenoma (... 1.300 1.6e-02
intraductal papillary-mucinous carcinoma... 1.200 2.9e-02
intraductal papillary-mucinous neoplasm ... 2.800 2.5e-03
juvenile dermatomyositis 1.286 2.4e-15
lung cancer -1.300 3.6e-02
oligodendroglioma 1.200 2.7e-02
osteosarcoma -2.446 1.8e-07
ovarian cancer -2.300 1.2e-06
pancreatic cancer 1.200 3.0e-03
pancreatic ductal adenocarcinoma liver m... 2.291 1.7e-03
Pick disease -1.200 1.3e-04
progressive supranuclear palsy -2.100 3.7e-03

AA Sequence

MSAAGAGAGVEAGFSSEELLSLRFPLHRACRDGDLATLCSLLQQTPHAHLASEDSFYGWTPVHWAAHFGK      1 - 70
LECLVQLVRAGATLNVSTTRYAQTPAHIAAFGGHPQCLVWLIQAGANINKPDCEGETPIHKAARSGSLEC     71 - 140
ISALVANGAHVDLRNASGLTAADIAQTQGFQECAQFLLNLQNCHLNHFYNNGILNGGHQNVFPNHISVGT    141 - 210
NRKRCLEDSEDFGVKKARTEAQSLDSAVPLTNGDTEDDADKMHVDREFAVVTDMKNSSSVSNTLTNGCVI    211 - 280
NGHLDFPSTTPLSGMESRNGQCLTGTNGISSGLAPGQPFPSSQGSLCISGTEEPEKTLRANPELCGSLHL    281 - 350
NGSPSSCIASRPSWVEDIGDNLYYGHYHGFGDTAESIPELNSVVEHSKSVKVQERYDSAVLGTMHLHHGS    351 - 420
//

Text Mined References (7)

PMID Year Title