Property Summary

NCBI Gene PubMed Count 39
PubMed Score 62.33
PubTator Score 37.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (7)

Disease log2 FC p
Amyotrophic lateral sclerosis 2.619 8.5e-06
cystic fibrosis -3.572 2.0e-07
lung adenocarcinoma -3.000 1.6e-11
lung cancer -4.500 2.7e-06
lung carcinoma -3.700 7.1e-15
malignant mesothelioma 3.100 1.1e-07
non-small cell lung carcinoma -3.300 8.9e-35

Gene RIF (34)

AA Sequence

MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAEL      1 - 70
KKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALENKLPVVEKFL     71 - 140
SDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWASRGGNLDVLKLLLNKGA    141 - 210
KISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLIMYGADLNI    211 - 280
KNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKTSRIATF                                   281 - 319
//

Text Mined References (38)

PMID Year Title