Property Summary

NCBI Gene PubMed Count 36
PubMed Score 58.16
PubTator Score 37.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 3.100 1.1e-07
cystic fibrosis -3.572 2.0e-07
Amyotrophic Lateral Sclerosis 2.619 8.5e-06
lung cancer -4.500 2.7e-06
lung adenocarcinoma -3.600 4.2e-19
lung carcinoma -3.700 7.1e-15
non-small cell lung carcinoma -3.300 8.9e-35

Synonym

Accession Q15327 Q96LE7
Symbols ALRP
CARP
C-193
CVARP
MCARP
bA320F15.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 IMPC Phenotype (1)

Gene RIF (32)

PMID Text
25961010 The association of ANKRD1 with antiapoptotic response suggests its role as myocyte survival factor during late stage heart disease, warranting further studies on ANKRD1 during end-stage heart failure.
25585647 To the Ankrd1, it is not responsive to the cardiotoxic drug Doxorubicin, suggesting that different mechanisms govern their expression in cardiac cells.
25125175 Report structure activity relationships for ANKRD1.
24531715 ANKRD1 has a significant role in the regulation of apoptosis in human ovarian cancer cells
24162774 HIV-1 gp120 upregulates the expression of ankyrin repeat domain 1 (ANKRD1) in human B cells
23572067 Report impact of ANKRD1 mutations associated with hypertrophic cardiomyopathy on contraction parameters of engineered heart tissue.
22892129 the 26S proteasome is the dominant regulator of Ankrd1/CARP degradation, and that Ankrd1/CARP half-life is significantly longer in cardiomyocytes (h) than endothelial cells (min).
22185618 Although analyzed in a limited number of patients, there is a considerable body of evidence that MARP proteins could be suitable candidates for prognostic and diagnostic biomarkers.
22085644 Ankrd1 and desmin may play important roles in airway smooth muscle cell homeostasis.
20860623 CARP and its regulator calpain 3 appear to occupy a central position in the important cell fate-governing NF-kappaB pathway in skeletal muscle
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20599664 p53 operates as an upstream effector of Ankrd1/CARP, by up regulating the proximal ANKRD1 promoter
20164196 CD45 lateral mobility is regulated by the spectrin-ankyrin cytoskeleton of T cells
19608031 CARP abnormalities may be involved in the pathogenesis of HCM.
19608031 Observational study of gene-disease association. (HuGE Navigator)
19608030 ANKRD1 is a novel DCM gene, with mutations present in 1.9% of DCM patients. The ANKRD1 mutations may cause DCM
19608030 Observational study of gene-disease association. (HuGE Navigator)
19589340 Data show that ANKRD1 is a short-lived protein whose levels are tightly regulated by the 26S proteasome.
19525294 On the basis of genetic and functional analysis of CARP mutations, ANKRD1 has been identified as a new gene associated with dilated cardiomyopathy, accounting for approximately 2% of the 231 cases studied.
19525294 Observational study of gene-disease association. (HuGE Navigator)
19359327 Augmented CARP expression may be a common molecular event in failing hearts regardless of cardiomyopathic aetiology.
18980987 We suggest that CDH1 cytoplasmic immunolocalization as a result of increased IGF-II levels identifies those nonmuscle invasive presentations most likely to recur
18976975 Knockdown of ankyrin repeat domain 1 (ANKRD1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18656235 Our results indicate that CARP is a sensitive and specific marker for rhabdomyosarcoma and that it will be useful for the differential diagnosis of rhabdomyosarcoma.
18273862 cloned both translocation breakpoints and mapped the ANKRD1 gene, encoding a cardiac transcriptional regulator, 130 kb proximally to the breakpoint on chromosome 10, in total anomalous pulmonary venous return, a congenital heart defect
17239933 CARP was expressed in renal podocytes at a high level in 10 of 13 cases of crescentic glomerulonephritis, 7 of 19 cases of diabetic nephropathy, and 12 of 20 cases of lupus nephritis.
16450059 CARP interacts with itself and desmin. CARP, ankrd2, and DARP contain potential coiled-coil dimerization motifs within their unique aminoterminal domains that mediate the formation of homo-dimers.
15698842 endogenous ANKRD1 and calsequestrin are co-enriched in piglet cardiac Purkinje cells
12679596 These findings suggest that type-specific expression patterns of ARPP and CARP are altered in skeletal muscles of amyotrophic lateral sclerosis.
12524226 CARP expression is observed by in situ hybridization in endothelial cells lining human atherosclerotic plaques, whereas lesion macrophages are devoid of CARP; it is induced by activin A in cultured intimal smooth muscle cells.
12054667 Cardiac ankyrin repeat protein, a negative regulator of cardiac gene expression, is augmented in human heart failure.

AA Sequence

MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAEL      1 - 70
KKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALENKLPVVEKFL     71 - 140
SDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWASRGGNLDVLKLLLNKGA    141 - 210
KISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLIMYGADLNI    211 - 280
KNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKTSRIATF                                   281 - 319
//

Text Mined References (35)

PMID Year Title
25961010 2015 Induction of Ankrd1 in Dilated Cardiomyopathy Correlates with the Heart Failure Progression.
25585647 2015 Profiling of skeletal muscle Ankrd2 protein in human cardiac tissue and neonatal rat cardiomyocytes.
25125175 2014 Probing muscle ankyrin-repeat protein (MARP) structure and function.
24531715 2015 Inhibition of ANKRD1 sensitizes human ovarian cancer cells to endoplasmic reticulum stress-induced apoptosis.
23572067 2013 Impact of ANKRD1 mutations associated with hypertrophic cardiomyopathy on contraction parameters of engineered heart tissue.
22892129 2012 26S proteasome regulation of Ankrd1/CARP in adult rat ventricular myocytes and human microvascular endothelial cells.
22185618 Muscle ankyrin repeat proteins: their role in striated muscle function in health and disease.
22085644 2012 Loss of desmin triggers mechanosensitivity and up-regulation of Ankrd1 expression through Akt-NF-?B signaling pathway in smooth muscle cells.
20860623 2010 A new pathway encompassing calpain 3 and its newly identified substrate cardiac ankyrin repeat protein is involved in the regulation of the nuclear factor-?B pathway in skeletal muscle.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20599664 2010 A novel role for cardiac ankyrin repeat protein Ankrd1/CARP as a co-activator of the p53 tumor suppressor protein.
20164196 2010 Dynamic regulation of CD45 lateral mobility by the spectrin-ankyrin cytoskeleton of T cells.
19608031 2009 Cardiac ankyrin repeat protein gene (ANKRD1) mutations in hypertrophic cardiomyopathy.
19608030 2009 ANKRD1, the gene encoding cardiac ankyrin repeat protein, is a novel dilated cardiomyopathy gene.
19589340 2009 Intracellular ANKRD1 protein levels are regulated by 26S proteasome-mediated degradation.
19525294 2009 Mutations in the ANKRD1 gene encoding CARP are responsible for human dilated cardiomyopathy.
19359327 2009 Upregulated expression of cardiac ankyrin repeat protein in human failing hearts due to arrhythmogenic right ventricular cardiomyopathy.
18980987 2008 Ankyrin repeat domain 1, ANKRD1, a novel determinant of cisplatin sensitivity expressed in ovarian cancer.
18656235 2008 Expression of cardiac ankyrin repeat protein, CARP, in malignant tumors: diagnostic use of CARP protein immunostaining in rhabdomyosarcoma.
18273862 2008 Transcriptional deregulation and a missense mutation define ANKRD1 as a candidate gene for total anomalous pulmonary venous return.
17239933 2007 Upregulated expression of cardiac ankyrin-repeated protein in renal podocytes is associated with proteinuria severity in lupus nephritis.
16450059 2005 Dimerization of the cardiac ankyrin protein CARP: implications for MARP titin-based signaling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15805281 2005 Identification of the genes involved in enhanced fenretinide-induced apoptosis by parthenolide in human hepatoma cells.
15698842 2005 ANKRD1 specifically binds CASQ2 in heart extracts and both proteins are co-enriched in piglet cardiac Purkinje cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14583192 2003 The muscle ankyrin repeat proteins: CARP, ankrd2/Arpp and DARP as a family of titin filament-based stress response molecules.
12679596 Altered expression of cardiac ankyrin repeat protein and its homologue, ankyrin repeat protein with PEST and proline-rich region, in atrophic muscles in amyotrophic lateral sclerosis.
12524226 2003 Cardiac ankyrin repeat protein (CARP) expression in human and murine atherosclerotic lesions: activin induces CARP in smooth muscle cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11309420 2001 Myopalladin, a novel 145-kilodalton sarcomeric protein with multiple roles in Z-disc and I-band protein assemblies.
11139470 2001 Transforming growth factor-beta/Smads signaling induces transcription of the cell type-restricted ankyrin repeat protein CARP gene through CAGA motif in vascular smooth muscle cells.
7730328 1995 Identification and characterization of a novel cytokine-inducible nuclear protein from human endothelial cells.