Property Summary

NCBI Gene PubMed Count 114
PubMed Score 98.27
PubTator Score 112.62

Knowledge Summary

Patent (1,555)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 1.5e-27

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (122)

PMID Text
27180960 We found no association between alcohol dependence and ANKK1 Taq 1A polymorphism
26970175 pattern of three Taq1 polymorphism of ANKK1 and DRD3 allele frequency, haplotypes and linkage disequilibrium was examined in five Punjabi ethnic groups
26664790 Ankyrin repeat and kinase domain containing I (ANKK1) and dopamine D2 receptor (DRD2) genes associated with psychopathic traits. We hypothesized that cognitive phenomena are associated with Taq IA SNP of the ANKK1 gene and with C957T SNP of DRD2.
26624925 The Taq1A polymorphism (dbSNP rs1800497), located ~9.5 kb downstream from DRD2 and in exon 8 of ANKK1 has been associated with smoking behavior.
26501178 Results revealed a significant interaction effect of BDNF Val66Met polymorphism and ANKK1 gene (DRD2 Taq1a/ANKK1 polymorphism) on loss aversion
26114114 These results support an association between ANKK1 and LTA genetic markers and vulnerability to schizophrenia and show the potential influence of just one copy of the mutant C or G allele in the Egyptian population.
26110876 The DRD2/ANKK1 TaqIA polymorphism might contribute to TS susceptibility.
25931179 Cognitive performance after traumatic brain injury is moderated by ANKK1 genetic variation.
25740917 The genotypic association of LEPR rs1137101, the allelic association of LEPR rs1137101, and ANKK1 rs1800497 with weight gain remained significant in epilepsy patients receiving valproic Acid.
25684044 the DRD2/ANKK1 Taq1A (rs1800497) SNP does not present contributions to the development of AD.
25641135 the rs1800497 locus may be associated with attention deficit hyperactivity disorder.[meta-analysis]
25633559 Findings extend those of previous studies reporting a negative relationship of the ANKK1 T allele with cognitive performance after traumatic brain injury.
25500252 The DRD2/ANKK1 TaqIA polymorphism was significantly associated with increased risk of opioid dependence.
25486867 Results demonstrate a link between the DRD2/ANKK1-TaqIA polymorphism and neurocognitive deficits related to long-term memory updating, and provide novel evidence that this effect is magnified in aging
25450229 This study finding significant excess of rare nonsynonymous variants exclusive to European Americans smokers in ANKK1.
25447970 The TaqIA genotype A1- is associated with impulse control disorder with a potentially addictive reinforcement and it may differentiate two types of disorders which are part of the impulse control disorders definition in Parkinson's disease patients.
25415204 analyzed selected SNPs polymorphisms in the DRD2 and ANKK1 genes in patients with alcohol dependence syndrome (169 Caucasian subjects) including a subgroup of individuals (n = 61) who have experienced at least one suicide attempt
25139281 The involvement of variants in DRD2 and ANKK1 in the etiology of nicotine dependence (ND) and alcohol dependence, is reported.
25073965 ANKK1 rs1800497 variant is associated with schizophrenia in females.
25049133 BMI gain in young women upon college entry was significantly associated with a ANKK1 SNP previously implicated in substance dependence risk
24713612 Study suggests that the DRD2/ANKK1 polymorphism rs1800497 interacts with ventral striatum activity during reward processing to affect working memory performance
24704945 DRD2/ANKK1 was significantly associated with elevated expression of t-DARPP in the caudate. Also, the A1 allele was significantly correlated with the total score of antemortem psychiatric symptoms.
24629326 in alcohol dependence, perceived impaired control is a cognitive mediator of impulsivity-related constructs that may be unaffected by DRD2/ANKK1 and neurocognitive processes underlying the retrieval of verbal information.
24528631 individuals who carry the T allele of rs1800497 in the ANKK1 gene reported higher subjective effects in response to acute cocaine administration.
24247049 An association between genotypes in the ANKK 1 gene polymorphism and sucrose preference in alcohol dependence has been demonstrated.
23947671 Upon stratifying for indoor tanning status, one ANKK1 SNP was positively associated with melanoma among non-tanners, while three DRD2 SNPS were positively associated with melanoma among tanners or non-tanners, depending on the SNP.
23840506 Identification of single nucleotide polymorphisms in dopaminergic genes associated with heroin dependence.
23828101 Findings of DRD2, ANKK1 and impulsivity are novel; they suggest that reward sensitivity and self-regulatory abilities might modulate the influences of sleep on weight gain
23740147 all the patients with prolactinomas respond in the same manner in terms of weight loss under dopaminergic treatment, regardless of the presence of A1 allele of the ANKK1
23691092 association of ANKK1/DRD2 further implicates the role of nicotine-related pathways and dopamine signaling in language processing, particularly in comprehension and phonological memory
23590110 Studied the distribution pattern of the three DRD2 and ANKK1 TaqI sites and also the frequencies of their haplotypes among Oraons (n = 48) and Mundas (n = 50)--the two linguistically distinct tribal population groups of Jharkhand.
23558112 The present study showed a significant difference in DRD2 -141C and ANKK1 TaqIA polymorphisms between the AD patients and the controls.
23443985 ANKK1 TaqIA polymorphism was found to be significantly associated with Alcohol Dependence.
23383291 COMT and ANKK1-Taq-Ia genetic polymorphisms influence visual working memory.
23303482 ANKK1 SNP rs877138 and ANKK1 SNP rs4938013 were associated with heroin dependence.
23302056 results suggest that direct parental social control may effectively suppress the genetic risk of the A1/A1 genotype on marijuana use in adolescence.
23203481 large-scale meta-analysis confirmed the association between the Taq1A polymorphism (located in the gene cluster ANKK1/DRD2) and Alcohol dependence
23153044 the presence of the DRD2/ANKK1 TaqIA A1 allele is prospectively associated with increased probability of initiating cigarette smoking and subsequent levels of smoking.
23118020 genetic association studies in population in Queensland: Data suggest that an SNP in ANKK1/DRD2 (rs1800497) is associated with risk of drug-induced akathisia in patients with schizophrenia who were treated with second-generation antipsychotics.
22970887 Results show significant association with SNP in ANKK1 and general alcohol consumption and abuse.
22967772 The association between 5 ANKK1, 54 DRD2, and 11 HTR2C SNPs and weight change during 8 weeks of olanzapine treatment was assessed in 4 pooled studies.
22893251 The findings of this study supported a possible role of ANKK1 and DRD2 variability on haloperidol efficacy.
22875483 For the ANKK1 polymorphism rs1800497, variant genotype & allele showed significant associations with migraine risk. 2 genotype interactions between ANKK1 rs1800497 & DBH rs72393728 polymorphisms showed significant risks.
22728571 The A1 allele of DRD2/ANKK1 TaqI A interacts with hypoemotionality to predict a novel index of problem drinking
22698582 Our study extends and confirms previous results and, for the first time, tested the gene-gene interaction between SLC6A3 and DRD2 in alcohol dependence.
22382052 The results of this study suggested that the DRD2 C957T polymorphism and the ANKK1 TaqIA polymorphism are key contributors to the genetic susceptibility to nicotine dependence.
22232965 It seems accurate to search for associations of polymorphisms in ANKK1 gene with dopaminergic system disorders.
21936764 Associations were found between ANKK1 haplotype rs4938015C_rs11604671A and age of onset of daily smoking, as well as with hazardous drinking.
21540761 Those having DRD2/ANKK1 Taq1A variant alleles and a history of depression are likely to experience particular difficulty when trying to stop smoking.
21510979 subjects with the DRD2/ANKK1 TaqI Al allele exhibit decreased corticostriatal activity in response to negatively charged affective stimuli compared with subjects homozygous for the A2 allele.
21352928 These results support the epistasis of catechol-O-methyltransferase and ANKK1 phenotypes in the flexible control of contextual information in humans
21261454 This study found a double dissociation for temporal discrimination: the DRD2/ANKK1-Taq1a polymorphism (A1+ allele) was associated with significantly greater variability for the 500-msec duration.
21168125 TTC12-ANKK1-DRD2s seemed to influence smoking behavior mainly in adolescence, and its effect is partially mediated by personality characteristics promoting drug-seeking behavior.
21070510 Study shows this gene is associated with ASPD without co-morbid alcoholism
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20845092 Results provide the first evidence of functional ANKK1 differences that are marked by TaqIA and could be associated with vulnerability to addiction.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20577142 These findings may provide initial evidence that the ALDH2 and DRD2/ANKK1 genes interact in specific subtypes of bipolar disorders.
20410875 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20199723 DRD2/ANKK1 Taq IA polymorphism is not associated with early infant temperament.
20180986 Observational study of gene-disease association. (HuGE Navigator)
20138949 This study demonestrated that the functional link between DRD2 and ANKK1 could account for the interaction in patient with schizophrenia.
20133381 This study evaluated the interaction of ANKK1, TTC12, sex, and continental ancestry in tobacco smokers.
20133381 Observational study of gene-disease association. (HuGE Navigator)
19914044 From the results of this study the alcohol-induced negative reinforcement may explain the greater risk for alcoholism associated with the A1 allele(ANKK1).
19914044 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19900188 Observational study of gene-disease association. (HuGE Navigator)
19897017 Presence of at least one copy of the A1 allele was associated with significantly higher Extraversion.
19717274 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19512960 Observational study of genetic testing. (HuGE Navigator)
19373123 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19339270 Observational study of gene-disease association. (HuGE Navigator)
19321766 Observational study of gene-disease association. (HuGE Navigator)
19291230 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19283474 ANKK1 mRNA is present in four cortical regions of the adult human brain. The TaqIA genotype may modulate a subject's susceptibility to alcohol-associated brain damage mediated by excitotoxicity.
19283474 Observational study of gene-disease association. (HuGE Navigator)
19046929 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19025655 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18927395 Observational study of gene-disease association. (HuGE Navigator)
18926547 DRD2/ANKK1 gene variations and some clinical factors may predict individual response to aripiprazole
18926547 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18828801 Variants in the two 3'-ends of ANKK1 are linked to the co-regulation of risk for comorbid alcohol and drug dependence.
18828801 Observational study of gene-disease association. (HuGE Navigator)
18698520 results confirm a published association between TAQ1 A (rs1800497) T allele and cognitive outcome measures 1 month after TBI and suggest that a haploblock of polymorphisms in ANKK1, not the adjacent DRD2 gene, has the highest association after TBI
18698520 Observational study of gene-disease association. (HuGE Navigator)
18690118 We explored associations of gene variants in the dopamine, opioid, and serotonin pathways with smoking reward ('liking') and reinforcement (latency to first puff and total puffs) as a function of negative mood.
18669994 The TaqI-A of the ANKK1 gene and the C957T of the DRD2 gene are epistatically associated with psychopathic traits in alcohol-dependent patients.
18669994 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18354387 study found a significant linkage with cigarette consumption and ANKK1 in African Americans, identified a possible causative single nucleotide polymorphism, and showed that the variant alters expression level of NF-kappaB-regulated genes
18354387 Observational study of gene-disease association. (HuGE Navigator)
18259088 This study finding significant associations between the A1 allele of the DRD2 TaqI A polymorphism and reward-related personality traits.
18075468 Taq1A polymorphism in DRD2 gene significantly influenced the time course of prolactin response to perphenazine
18063936 A significant association was found between the dopamine D2 receptor gene TaqI A genotype and "Eros" (a loving style characterized by a tendency to develop intense emotional experiences based on the physical attraction to the partner).
18058350 These findings suggest a modest association between DRD2 genotype and quitting behavior in male cigarette smokers in Egypt.
18058343 These data suggest that bupropion may be effective for smoking cessation only in a subgroup of smokers with the DRD2 Taq1 A2/A2 genotype.
18037170 Findings do not support the hypothesis that two of the most prominent dopaminergic candidate loci (DRD2 Taq Ia and COMT Val158Met) effect prepulse inhibition the study does not exclude the relevance of the dopaminergic system in general.
17850642 Observational study of gene-disease association. (HuGE Navigator)
17850642 More extensive genotyping across DRD2 and ANKK1 suggests that the association with alcohol dependence observed in this region may be due to genetic variants in the ANKK1 gene.
17767146 The Taq1A of D2 dopamine receptor is associated with tardive dyskinesia .
17761687 Observational study of gene-disease association. (HuGE Navigator)
17761687 association studies of alcohol dependence and 43 SNPs mapped to the gene cluster of NCAM1, TTC12, ANKK1 and DRD2
17671965 Polymorphisms TaqI A of the DRD2 is associated with childhood attention deficit hyperactivity disorder
17669630 In our study DRD2 C939T was in strong linkage disequilibrium with TaqIA in tardive dyskinesia in schizophrenia.
17453061 Results of this meta-analysis support the association of the DRD2 Taq1A polymorphism with alcoholism.
17446975 study supports other family-based association tests that have reported no association between the DRD2 TaqIA polymorphism and alcohol abuse and dependence
17189962 Smokers homozygous for the DRD2 TaqI-B2 allele experience progressive improvement in self-reported withdrawal symptoms while smokers with the TaqI-B1 allele show little change.
17120049 A DRD2 polymorphic TaqIA restriction endonuclease site is associated with increase risk of violence or serious delinquency in male adolescents and young adults (ages 12 to 23).
17085484 Observational study of gene-disease association. (HuGE Navigator)
17069991 No support for an association between early onset alcohol use disorders and the DRD2 TaqIA polymorphism.
16869231 Utilize the attention network test and find that carriers of the A1 allele show gene-associated functional activation in an anatomically specific, dopamine-rich region of the brain comprising the anterior cingulate gyrus.
16032443 alcoholic and non-alcoholic smokers presented a higher frequency of the DRD2 TaqI A1 allele (P = 0.04) than non-smoking controls
16026865 This study investigated two dopaminergic candidate genes (COMT VAL158MET and DRD2 TAQ IA) for endophenotypes of cognitive functioning. Results showed an interaction effect of DRD2xVAL on interference performance as measured by the STROOP-test.
15939106 APM linkage analysis suggested that the DD2R gene TaqI polymorphism had evidence of linkage with blood pressure, as well as with obesity.
15812318 for men, but not for women, we observed a strong and specific association between low neuroticism-anxiety and the A1+ allele of the DRD2 TaqI A polymorphism
15545020 the TaqIA1 allele of the dopamine receptor gene D2 has been associated with alcoholism, as well as with other addictive behaviours
15542731 It is suggested that in methamphetamine psychosis the TaqI A polymorphism of dopamine D2 receptor not only regulates prolongation of psychosis symptoms but also influences the form of the temporal lobe.
15146457 changes in ANKK1 activity may provide an alternative explanation for previously described associations between the DRD2 Taq1A RFLP and neuropsychiatric disorders such as addiction
12762588 a possible linkage with schizophrenia for the Taq1A marker but not for the Taq1B marker of DRD2 gene.
12605103 There is a lack of association in Japanese patients between neuroleptic malignant syndrome and the TaqI A polymorphism of this gene.
12555236 study suggests that only the TaqI A polymorphism is associated with neuroleptic malignant syndrome, but the -141 C Ins/Del and Ser(9)Gly polymorphisms are not
12151753 Among the aged with cognitive impairments, the homozygous status for the A2 allele of the DRD2 Taq I polymorphism is associated with diminished cognitive performance and increased atrophy in the striatum.

AA Sequence

MAADPTELRLGSLPVFTRDDFEGDWRLVASGGFSQVFQARHRRWRTEYAIKCAPCLPPDAASSDVNYLIE      1 - 70
EAAKMKKIKFQHIVSIYGVCKQPLGIVMEFMANGSLEKVLSTHSLCWKLRFRIIHETSLAMNFLHSIKPP     71 - 140
LLHLDLKPGNILLDSNMHVKISDFGLSKWMEQSTRMQYIERSALRGMLSYIPPEMFLESNKAPGPKYDVY    141 - 210
SFAIVIWELLTQKKPYSGFNMMMIIIRVAAGMRPSLQPVSDQWPSEAQQMVDLMKRCWDQDPKKRPCFLD    211 - 280
ITIETDILLSLLQSRVAVPESKALARKVSCKLSLRQPGEVNEDISQELMDSDSGNYLKRALQLSDRKNLV    281 - 350
PRDEELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGAD    351 - 420
ANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQADPNLH    421 - 490
EAEGKTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKSGAVPDALDQSG    491 - 560
YGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANMGALGAVNWTPL    561 - 630
HLAARHGEEAVVSALLQCGADPNAAEQSGWTPLHLAVQRSTFLSVINLLEHHANVHARNKVGWTPAHLAA    631 - 700
LKGNTAILKVLVEAGAQLDVQDGVSCTPLQLALRSRKQGIMSFLEGKEPSVATLGGSKPGAEMEI         701 - 765
//

Text Mined References (115)

PMID Year Title
27180960 2016 Case control study of ANKK1 Taq 1A polymorphism in patients with alcohol dependence classified according to Lesch's typology.
26970175 2016 Analysis of ANKKI (rs1800497) and DRD2 (rs1079597, rs1800498) variants in five ethnic groups from Punjab, North-West India.
26664790 2015 The ANKK1/DRD2 locus is a genomic substrate for affective priming and recognition of angry faces.
26624925 2015 The significant association of Taq1A genotypes in DRD2/ANKK1 with smoking cessation in a large-scale meta-analysis of Caucasian populations.
26501178 2015 On the genetics of loss aversion: An interaction effect of BDNF Val66Met and DRD2/ANKK1 Taq1a.
26114114 2015 Association between ANKK1 (rs1800497) and LTA (rs909253) Genetic Variants and Risk of Schizophrenia.
26110876 2015 Association between DRD2/ANKK1 TaqIA Polymorphism and Susceptibility with Tourette Syndrome: A Meta-Analysis.
25931179 Posttraumatic Brain Injury Cognitive Performance Is Moderated by Variation Within ANKK1 and DRD2 Genes.
25740917 2015 Association of LEPR and ANKK1 Gene Polymorphisms with Weight Gain in Epilepsy Patients Receiving Valproic Acid.
25684044 2015 Association study of the SLC6A3 VNTR (DAT) and DRD2/ANKK1 Taq1A polymorphisms with alcohol dependence in a population from northeastern Brazil.
25641135 2015 Association between ANKK1 (rs1800497) polymorphism of DRD2 gene and attention deficit hyperactivity disorder: a meta-analysis.
25633559 2015 Association of a common genetic variant within ANKK1 with six-month cognitive performance after traumatic brain injury.
25500252 2015 Association between DRD2/ANKK1 TaqIA polymorphism and common illicit drug dependence: evidence from a meta-analysis.
25486867 2015 Influences of a DRD2 polymorphism on updating of long-term memory representations and caudate BOLD activity: magnification in aging.
25450229 2015 The contribution of rare and common variants in 30 genes to risk nicotine dependence.
25447970 2015 The addiction-related gene ANKK1 in Parkinsonian patients with impulse control disorder.
25415204 2014 Suicidal behavior and haplotypes of the dopamine receptor gene (DRD2) and ANKK1 gene polymorphisms in patients with alcohol dependence--preliminary report.
25139281 2015 Updated findings of the association and functional studies of DRD2/ANKK1 variants with addictions.
25073965 2014 Identification of ANKK1 rs1800497 variant in schizophrenia: new data and meta-analysis.
25049133 2014 Who gains? Genetic and neurophysiological correlates of BMI gain upon college entry in women.
24713612 2014 DRD2/ANKK1 polymorphism modulates the effect of ventral striatal activation on working memory performance.
24704945 2014 Elevated postmortem striatal t-DARPP expression in schizophrenia and associations with DRD2/ANKK1 polymorphism.
24629326 2014 Impulsivity-related cognition in alcohol dependence: Is it moderated by DRD2/ANKK1 gene status and executive dysfunction?
24528631 2014 A variant in ANKK1 modulates acute subjective effects of cocaine: a preliminary study.
24247049 2013 The effect of selected polymorphisms of the dopamine receptor gene DRD2 and the ANKK-1 on the preference of concentrations of sucrose solutions in men with alcohol dependence.
23947671 2013 A pilot study of genetic variants in dopamine regulators with indoor tanning and melanoma.
23840506 2013 Multivariate analysis of dopaminergic gene variants as risk factors of heroin dependence.
23828101 2014 Impulsivity and genetic variants in DRD2 and ANKK1 moderate longitudinal associations between sleep problems and overweight from ages 5 to 11.
23740147 2014 The effect of the ANKK1/DRD2 Taq1A polymorphism on weight changes of dopaminergic treatment in prolactinomas.
23691092 2013 Associations of prenatal nicotine exposure and the dopamine related genes ANKK1 and DRD2 to verbal language.
23590110 2013 Dopamine D2 receptor and ankyrin repeat and kinase domain containing 1 genes among the two linguistically distinct tribal populations of Ranchi district, Jharkhand, India.
23558112 The association of DRD2 -141C and ANKK1 TaqIA polymorphisms with alcohol dependence in Korean population classified by the Lesch typology.
23443985 DRD2 and ANKK1 gene polymorphisms and alcohol dependence: a case-control study among a Mendelian population of East Asian ancestry.
23383291 2013 COMT and ANKK1-Taq-Ia genetic polymorphisms influence visual working memory.
23303482 2013 ANKK1, TTC12, and NCAM1 polymorphisms and heroin dependence: importance of considering drug exposure.
23302056 2013 Interaction of the TaqIA polymorphism and poor parental socialization on changes in adolescent marijuana use.
23203481 2013 A large-scale meta-analysis of the association between the ANKK1/DRD2 Taq1A polymorphism and alcohol dependence.
23153044 2013 A prospective study of the effects of the DRD2/ANKK1 TaqIA polymorphism and impulsivity on smoking initiation.
23118020 2013 DRD2/ANKK1 Taq1A (rs 1800497 C>T) genotypes are associated with susceptibility to second generation antipsychotic-induced akathisia.
22970887 2013 The association between DRD2/ANKK1 and genetically informed measures of alcohol use and problems.
22967772 2012 Pharmacogenomic associations with weight gain in olanzapine treatment of patients without schizophrenia.
22893251 2013 Influence of ANKK1 and DRD2 polymorphisms in response to haloperidol.
22875483 2013 Identification of a novel ANKK1 and other dopaminergic (DRD2 and DBH) gene variants in migraine susceptibility.
22728571 2012 DRD2/ANKK1 TaqI A genotype moderates the relationship between alexithymia and the relative value of alcohol among male college binge drinkers.
22698582 2012 DRD2/ANKK1 TaqIA and SLC6A3 VNTR polymorphisms in alcohol dependence: association and gene-gene interaction study in a population of Central Italy.
22382052 2012 A DRD2 and ANKK1 haplotype is associated with nicotine dependence.
22232965 [ANKK1 gene in psychiatry].
21936764 2012 The role of ANKK1 and TTC12 genes on drinking behaviour in tobacco dependent subjects.
21540761 2011 Association between DRD2/ANKK1 Taq1A genotypes, depression and smoking cessation with nicotine replacement therapy.
21510979 2011 DRD2/ANKK1 TaqI A polymorphism affects corticostriatal activity in response to negative affective facial stimuli.
21352928 2011 COMT and ANKK1 gene-gene interaction modulates contextual updating of mental representations.
21261454 2011 Double dissociation of dopamine genes and timing in humans.
21168125 2011 TTC12-ANKK1-DRD2 and CHRNA5-CHRNA3-CHRNB4 influence different pathways leading to smoking behavior from adolescence to mid-adulthood.
21070510 2012 Interaction between ALDH2*1*1 and DRD2/ANKK1 TaqI A1A1 genes may be associated with antisocial personality disorder not co-morbid with alcoholism.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20845092 2011 The ANKK1 protein associated with addictions has nuclear and cytoplasmic localization and shows a differential response of Ala239Thr to apomorphine.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20577142 2010 The ALDH2 and DRD2/ANKK1 genes interacted in bipolar II but not bipolar I disorder.
20410875 2010 Epistasis of the DRD2/ANKK1 Taq Ia and the BDNF Val66Met polymorphism impacts novelty seeking and harm avoidance.
20199723 2010 [DRD2/ANKK1 Taq IA polymorphism and early infant temperament].
20180986 2010 CLOCK is suggested to associate with comorbid alcohol use and depressive disorders.
20138949 2010 A genetic schizophrenia-susceptibility region located between the ANKK1 and DRD2 genes.
20133381 2010 Sex differences in TTC12/ANKK1 haplotype associations with daily tobacco smoking in Black and White Americans.
19914044 2009 Effect of the TaqIA polymorphism on ethanol response in the brain.
19900188 2010 The D2 dopamine receptor gene variant C957T affects human fear conditioning and aversive priming.
19897017 2010 Variation in DRD2 dopamine gene predicts Extraverted personality.
19717274 2010 Genetic, personality, and environmental predictors of drug use in adolescents.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19512960 2009 Genetic diagnostics of functional variants of the human dopamine D2 receptor gene.
19373123 2009 Genetic variants altering dopamine D2 receptor expression or function modulate the risk of opiate addiction and the dosage requirements of methadone substitution.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19321766 2009 Dopamine DRD2 polymorphism alters reversal learning and associated neural activity.
19291230 2009 Effects of dopamine-related gene-gene interactions on working memory component processes.
19283474 2009 Cortical NMDA receptor expression in human chronic alcoholism: influence of the TaqIA allele of ANKK1.
19046929 2009 Differential effects of 5-HTTLPR and DRD2/ANKK1 polymorphisms on electrocortical measures of error and feedback processing in children.
19025655 2008 Behavioral phenotypes of impulsivity related to the ANKK1 gene are independent of an acute stressor.
18927395 2008 Relation between obesity and blunted striatal response to food is moderated by TaqIA A1 allele.
18926547 2009 Effects of DRD2/ANKK1 gene variations and clinical factors on aripiprazole efficacy in schizophrenic patients.
18828801 2008 Haplotypic variants in DRD2, ANKK1, TTC12, and NCAM1 are associated with comorbid alcohol and drug dependence.
18698520 2008 Single nucleotide polymorphisms in ANKK1 and the dopamine D2 receptor gene affect cognitive outcome shortly after traumatic brain injury: a replication and extension study.
18690118 2008 Dopamine and opioid gene variants are associated with increased smoking reward and reinforcement owing to negative mood.
18669994 2008 DRD2 and ANKK1 genotype in alcohol-dependent patients with psychopathic traits: association and interaction study.
18354387 2009 Significant association of ANKK1 and detection of a functional polymorphism with nicotine dependence in an African-American sample.
18259088 2007 Association study of dopamine receptor D2 TaqI A polymorphism and reward-related personality traits in healthy Korean young females.
18075468 2007 CYP2D6 and DRD2 genes differentially impact pharmacodynamic sensitivity and time course of prolactin response to perphenazine.
18063936 2007 Genetic loading on human loving styles.
18058350 2007 DRD2/ANKK1 TaqI polymorphism and smoking behavior of Egyptian male cigarette smokers.
18058343 2007 Bupropion efficacy for smoking cessation is influenced by the DRD2 Taq1A polymorphism: analysis of pooled data from two clinical trials.
18037170 2008 D2 receptor density and prepulse inhibition in humans: negative findings from a molecular genetic approach.
17850642 2007 Family-based association analyses of alcohol dependence phenotypes across DRD2 and neighboring gene ANKK1.
17767146 2007 Meta-analysis of two dopamine D2 receptor gene polymorphisms with tardive dyskinesia in schizophrenia patients.
17761687 2007 Association of haplotypic variants in DRD2, ANKK1, TTC12 and NCAM1 to alcohol dependence in independent case control and family samples.
17671965 2007 Polymorphisms TaqI A of the DRD2, BalI of the DRD3, exon III repeat of the DRD4, and 3' UTR VNTR of the DAT: association with childhood ADHD in male African-Caribbean cocaine dependents?
17669630 2007 Support for an association of the C939T polymorphism in the human DRD2 gene with tardive dyskinesia in schizophrenia.
17453061 2007 Association of the DRD2 gene Taq1A polymorphism and alcoholism: a meta-analysis of case-control studies and evidence of publication bias.
17446975 2007 Between- and within-family association test of the dopamine receptor D2 TaqIA polymorphism and alcohol abuse and dependence in a general population sample of adults.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17189962 2007 The DRD2 TaqI-B polymorphism and its relationship to smoking abstinence and withdrawal symptoms.
17120049 2007 Contributions of the DAT1 and DRD2 genes to serious and violent delinquency among adolescents and young adults.
17085484 2006 Haplotype spanning TTC12 and ANKK1, flanked by the DRD2 and NCAM1 loci, is strongly associated to nicotine dependence in two distinct American populations.
17069991 2007 Test of association between TaqIA A1 allele and alcohol use disorder phenotypes in a sample of adolescent patients with serious substance and behavioral problems.
16869231 2006 Evaluation of a structural polymorphism in the ankyrin repeat and kinase domain containing 1 (ANKK1) gene and the activation of executive attention networks.
16032443 2006 Polymorphisms in the DBH and DRD2 gene regions and smoking behavior.
16026865 2005 The influence of the dopaminergic system on cognitive functioning: A molecular genetic approach.
15939106 2005 An affected pedigree member analysis of linkage between the dopamine D2 receptor gene TaqI polymorphism and obesity and hypertension.
15812318 2005 Sexually dimorphic link between dopamine D2 receptor gene and neuroticism-anxiety.
15545020 2004 IDRD2 TaqIA polymorphism is associated with urinary homovanillic acid levels in a sample of Spanish male alcoholic patients.
15542731 2004 A polymorphism of DRD2 gene and brain atrophy in methamphetamine psychosis.
15146457 2004 Identification and characterization of ANKK1: a novel kinase gene closely linked to DRD2 on chromosome band 11q23.1.
14741327 2004 The 3' region of the DRD2 gene is involved in genetic susceptibility to schizophrenia.
12762588 2003 Analysis of the linkage of the Taq1A and Taq1B loci of the dopamine D2 receptor gene with schizophrenia in patients and their siblings.
12605103 2003 Lack of association in Japanese patients between neuroleptic malignant syndrome and the TaqI A polymorphism of the dopamine D2 receptor gene.
12555236 2003 Relationship between functional dopamine D2 and D3 receptors gene polymorphisms and neuroleptic malignant syndrome.
12471243 2002 The protein kinase complement of the human genome.
12151753 2002 Dopamine DRD2 Taq I polymorphism associates with caudate nucleus volume and cognitive performance in memory impaired subjects.