Property Summary

NCBI Gene PubMed Count 60
PubMed Score 109.55
PubTator Score 114.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count
Craniometaphyseal dysplasia 5

Expression

  Differential Expression (23)

Disease log2 FC p
active ulcerative colitis -1.019 4.6e-03
adult high grade glioma -2.400 4.7e-05
astrocytic glioma -1.600 1.4e-02
Astrocytoma, Pilocytic -1.200 6.0e-03
atypical teratoid / rhabdoid tumor -3.600 6.3e-11
Breast cancer 4.300 2.5e-02
cutaneous lupus erythematosus -1.100 1.6e-03
cystic fibrosis -2.600 2.3e-06
ependymoma -2.100 1.4e-02
fibroadenoma 1.100 7.2e-03
glioblastoma -2.000 1.8e-06
group 4 medulloblastoma -1.100 2.3e-04
lung cancer 1.700 1.1e-03
lung carcinoma 2.300 2.1e-34
medulloblastoma, large-cell -1.900 2.1e-04
oligodendroglioma -1.200 1.0e-10
ovarian cancer -1.500 3.8e-05
pancreatic cancer 1.700 4.8e-03
pancreatic ductal adenocarcinoma liver m... -1.049 1.7e-02
primitive neuroectodermal tumor -2.000 2.0e-03
psoriasis -1.400 1.2e-09
subependymal giant cell astrocytoma -2.794 9.6e-04
tuberculosis -1.200 2.3e-04

Protein-protein Interaction (8)

Gene RIF (51)

AA Sequence

MVKFPALTHYWPLIRFLVPLGITNIAIDFGEQALNRGIAAVKEDAVEMLASYGLAYSLMKFFTGPMSDFK      1 - 70
NVGLVFVNSKRDRTKAVLCMVVAGAIAAVFHTLIAYSDLGYYIINKLHHVDESVGSKTRRAFLYLAAFPF     71 - 140
MDAMAWTHAGILLKHKYSFLVGCASISDVIAQVVFVAILLHSHLECREPLLIPILSLYMGALVRCTTLCL    141 - 210
GYYKNIHDIIPDRSGPELGGDATIRKMLSFWWPLALILATQRISRPIVNLFVSRDLGGSSAATEAVAILT    211 - 280
ATYPVGHMPYGWLTEIRAVYPAFDKNNPSNKLVSTSNTVTAAHIKKFTFVCMALSLTLCFVMFWTPNVSE    281 - 350
KILIDIIGVDFAFAELCVVPLRIFSFFPVPVTVRAHLTGWLMTLKKTFVLAPSSVLRIIVLIASLVVLPY    351 - 420
LGVHGATLGVGSLLAGFVGESTMVAIAACYVYRKQKKKMENESATEGEDSAMTDMPPTEEVTDIVEMREE    421 - 490
NE                                                                        491 - 492
//

Text Mined References (60)

PMID Year Title