Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.71
PubTator Score 2.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 2.400 1.9e-03
ependymoma 2.800 2.7e-03
oligodendroglioma 2.100 2.8e-03
glioblastoma 1.400 3.3e-04
Atopic dermatitis -1.300 9.0e-04
intraductal papillary-mucinous carcinoma... 1.400 3.5e-02
intraductal papillary-mucinous neoplasm ... 2.700 2.2e-04
interstitial cystitis -2.100 5.4e-06
pediatric high grade glioma 1.200 3.9e-05
psoriasis -2.000 1.2e-114
lung carcinoma -1.300 2.8e-04
ovarian cancer -1.700 1.3e-05
chronic rhinosinusitis -1.296 3.3e-02

Synonym

Accession Q8N957
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEASLTRRLLFKDRHFTCSKIIGRRFACFAQRLSHRRKQSQCDLLNESTGQLPTTCSSAASNSINWNCRV      1 - 70
KMTQQMQNLHLCQSKKHSAPSSPNAAKRLYRNLSEKLKGSHSSFDEAYFRTRTDRLSLRKTSVNFQGNEA     71 - 140
MFEAVEQQDMDAVQILLYQYTPEELDLNTPNSEGLTPLDIAIMTNNVPIARILLRTGARESPHFVSLESR    141 - 210
AMHLNTLVQEAQERVSELSAQVENEGFTLDNTEKEKQLKAWEWRYRLYRRMKTGFEHARAPEMPTNVCLM    211 - 280
VTSSTSLTVSFQEPLSVNAAVVTRYKVEWSMSEDFSPLAGEIIMDNLQTLRCTITGLTMGQQYFVQVSAY    281 - 350
NMKGWGPAQTTTPACASPSNWKDYDDREPRHKGQSEVLEGLLQQVRALHQHYSCRESTKLQTTGRKQSVS    351 - 420
RSLKHLFHSSNKFVKTLKRGLYIAVIFYYKDNILVTNEDQVPIVEIDDSHTSSITQDFLWFTKLSCMWED    421 - 490
IRWLRQSIPISSSSSTVLQTRQKMLAATAQLQNLLGTHNLGRVYYEPIKDRHGNILIVTIREVEMLYSFF    491 - 560
NGKWMQISKLQSQRKSLSTPEEPTALDILLITIQDILSYHKRSHQRLFPGLYLGYLKLCSSVDQIKVLVT    561 - 630
QKLPNILCHVKIRENNNISREEWEWIQKLSGSESMESVDHTSDCPMQLFFYELQMAVKALLQQINIPLHQ    631 - 700
ARNFRLYTQEVLEMGHNVSFLLLLPASDDVCTAPGQNNPYTPHSGFLNLPLQMFELGIVACFT           701 - 763
//

Text Mined References (6)

PMID Year Title
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
21668797 2011 A genome-wide association study of DSM-IV cannabis dependence.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18391950 2008 Identification of ten loci associated with height highlights new biological pathways in human growth.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.