Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.36
PubTator Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.0
Disease Target Count Z-score Confidence
Loeys-Dietz syndrome 22 4.576 2.3
Ehlers-Danlos syndrome 43 3.961 2.0

Expression

AA Sequence

MLRLPKKGLPRFEQVQDEDTYLENLAIQRNASAFFEKYDRSEIQELLTTALVSWLSAKEDVRSQVDLPCG      1 - 70
IMSQMNNVGFSTAILLTPVDPTALLDYREVHQMIRELAIGIYCLNQIPSISLEANYDQSSSCQLPPAYYD     71 - 140
TRIGQILINIDYMLKALWHGIYMPKEKRARFSELWRAIMDIDPDGKPQTNKDIFSEFSSAGLTDITKDPD    141 - 210
FNEIYDEDVNEDPTYDPNSPEETAVFMKYAENIMLKLTFSTTQIQQYENVFIFETGYWLTNAIKYNQDYL    211 - 280
DICTYQRLQQRLYLQKKIIQKHFEKKKDIRRGIGYLKLICFLIPFLLSLKKKMKVPYLSSLLQPFSDDKV    281 - 350
KTERELPPFIYGRDFKCQNFHYKENQYFHVHGGIEFDISTPSIENALEDFQKNLEKIRDCAANTFIEDSG    351 - 420
YKEYYSIPVMEFHGKSYYVIYFELETFYQQLYKTQWWGAINEIVNNLRLKRLPLTDAQLHEQFKKKLGFK    421 - 490
RAMKCKSIPFGMKSAVERGLSAVFHTFSRKTSSSTINVSDEAGYTIFHHAALHNRVSIICQLCNANFKVN    491 - 560
QRRFVTFSQGPTPLHLAAQACSLETTVCLLCSKADYTLSEKRGWMPIHFAAFYDNVCIIIALCRKDPSLL    561 - 630
EAEATAENQCTPLLLAATSGALDTIQYLFSIGANWRKTDIKGNNIIHLSVLTFHTEVLKYIIKLNIPELP    631 - 700
VWKTLVEMLQCESYKRRMMAVMSLEVICLANDQYWRCILDAGTIPALINLLKSSKIKLQCKTVGLLSNIS    701 - 770
THKSAVHALVEAGGIPSLINLLVCDEPEVHSRCAVILYDIAQCENKDVIAKYNGIPSLINLLNLNIENVL    771 - 840
VNVMNCIRVLCIGNENNQRAVREHKGLPYLIRFLSSDSDVLKAVSSAAIAEVGRDNKEIQDAIAMEGAIP    841 - 910
PLVALFKGKQISVQMKGAMAVESLASHNALIQKAFLEKSLTKYLLKLLKAFQIDVKEQGAVALWALAGQT    911 - 980
LKQQKYMAEQIGYSFIINMLLSPSAKMQYVGGEAVIALSKDSRMHQNQICEGNGIAPLVRLLRISTIAEG    981 - 1050
TLLSVIRAVGSICIGVAHTSNPVSQQLVVDENAFPVLIQLLRNHPSPNIKVEVAFSLACIVLGNDVLQKD   1051 - 1120
LHENEGFEYADVLYLLHSTEKDICLRAGYALTLFAFNNRFQQYLILESGIMTISIFERFLESTVETEKAM   1121 - 1190
AAFQIVVLAKVIRDMDHITLSARGVTILVDSLYSVQTSTIVLTGNLIASLAHSRAGIPEAFTTLGTIQRL   1191 - 1260
CYHLYSGIEEVRAACSSALGYLTYNANAFRILLKECRNKPNQFIRIKNNISRDASINPAFLKEFQMQQTL   1261 - 1330
VGLPSLSLEKNGGPSIIPIFKRGKEHRRKLKPKIQPKDSLTLLPPVTNFMGLFKATKKTKDSHNIFSFSS   1331 - 1400
TITSDITNVSRPRIVCLNQLGKHVQKANPEPAEG                                       1401 - 1434
//

Text Mined References (7)

PMID Year Title