Property Summary

NCBI Gene PubMed Count 73
PubMed Score 120.47
PubTator Score 73.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 1.4
Disease Target Count Z-score Confidence
Autism spectrum disorder 101 0.0 5.0
Disease Target Count Z-score Confidence
Long QT syndrome 39 0.0 4.0
Disease Target Count Z-score Confidence
Heart disease 306 4.451 2.2
Spinocerebellar ataxia type 5 6 4.026 2.0

Expression

  Differential Expression (31)

Disease log2 FC p
acute myeloid leukemia -1.200 2.8e-02
adrenocortical carcinoma -1.763 3.5e-02
adult high grade glioma -1.500 2.7e-06
Astrocytoma, Pilocytic -1.200 6.5e-07
Atopic dermatitis -1.700 6.1e-03
atypical teratoid / rhabdoid tumor -2.400 5.0e-05
breast carcinoma -1.700 2.7e-16
colon cancer -3.600 6.9e-06
dermatomyositis -1.500 9.6e-04
Down syndrome 1.100 2.7e-02
ductal carcinoma in situ -1.800 7.3e-03
ependymoma -1.400 5.3e-07
glioblastoma -1.500 1.0e-04
group 3 medulloblastoma -1.200 7.0e-04
hereditary spastic paraplegia -1.044 1.7e-03
intraductal papillary-mucinous adenoma (... -1.900 3.6e-04
intraductal papillary-mucinous carcinoma... -2.000 4.7e-04
intraductal papillary-mucinous neoplasm ... -2.200 4.1e-03
invasive ductal carcinoma -1.754 1.3e-02
lung cancer -2.900 2.0e-05
lung carcinoma 1.500 1.6e-06
malignant mesothelioma -3.300 5.7e-07
medulloblastoma, large-cell -3.800 1.6e-04
nephrosclerosis -1.534 1.9e-03
non-small cell lung cancer -2.278 1.2e-18
oligodendroglioma -1.100 1.4e-11
ovarian cancer -1.900 7.5e-06
Pick disease -1.400 1.0e-03
pituitary cancer 1.300 5.5e-06
primitive neuroectodermal tumor -1.500 1.5e-02
psoriasis -1.700 8.0e-04

Gene RIF (41)

AA Sequence

MMNEDAAQKSDSGEKFNGSSQRRKRPKKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHL      1 - 70
AAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQE     71 - 140
NHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAAL    141 - 210
LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTN    211 - 280
MVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKH    281 - 350
LLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKY    351 - 420
GASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALV    421 - 490
DARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLAT    491 - 560
KKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGY    561 - 630
TPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLH    631 - 700
LAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQ    701 - 770
QGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMT    771 - 840
EVLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTL    841 - 910
SHASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGA    911 - 980
MRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAP    981 - 1050
PPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEI   1051 - 1120
LNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTK   1121 - 1190
RIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRL   1191 - 1260
LCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKF   1261 - 1330
VVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHI   1331 - 1400
FSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEID   1401 - 1470
MTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKA   1471 - 1540
AEEEPGEPFEIVERVKEDLEKVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLE   1541 - 1610
ITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGK   1611 - 1680
DIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGLAPEPLPT   1681 - 1750
VKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAP   1751 - 1820
GSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPSAKTERHSPASSSSKTEKHSPVSPSTKTERH   1821 - 1890
SPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKH   1891 - 1960
LPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVE   1961 - 2030
KEKGPILTQREAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVP   2031 - 2100
EEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVL   2101 - 2170
TSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAETP   2171 - 2240
ETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTKDITGGSEERGATVTEDSETSTESFQKE   2241 - 2310
ATLGSPKDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETK   2311 - 2380
ALPLPEASVKTDTGTESKPQGVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHK   2381 - 2450
TPDSLEPSPLKESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDD   2451 - 2520
SLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFK   2521 - 2590
MVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSGEDESGVPVLVTSESRKV   2591 - 2660
SSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEP   2661 - 2730
GKSEEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDD   2731 - 2800
VDEQPVIYKESLALQGTHEKDTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSS   2801 - 2870
IQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSE   2871 - 2940
ESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTLWEMQSDS   2941 - 3010
VSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTP   3011 - 3080
DTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSEDVKEG   3081 - 3150
ATGADPLPLETSAESLALSESKETVDDEADLLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSV   3151 - 3220
GTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTA   3221 - 3290
PMENVPFTESKSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQ   3291 - 3360
LSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRERAEELELESEE   3361 - 3430
GATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQE   3431 - 3500
IVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDPQDEQERIE   3501 - 3570
ERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKI   3571 - 3640
NRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPP   3641 - 3710
IVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTE   3711 - 3780
TSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVE   3781 - 3850
SADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEIMV   3851 - 3920
QGMPQEPVNIEEGDGYSKVIKRVVLKSDTEQSEDNNE                                    3921 - 3957
//

Text Mined References (82)

PMID Year Title