Property Summary

NCBI Gene PubMed Count 83
PubMed Score 282.18
PubTator Score 246.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Bone Diseases, Developmental 27 0.0 0.0
Spherocytosis, Type 1 1 0.0 0.0
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 0.6
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.9
Disease Target Count Z-score Confidence
Asthma 385 0.0 1.0
Type 2 diabetes mellitus 272 0.0 3.0
Disease Target Count Z-score Confidence
Hereditary elliptocytosis 22 4.299 2.1
Congenital hemolytic anemia 32 0.0 4.0
Disease Target Count Z-score Confidence
Anemia 365 4.518 2.3
Neuropathy 261 3.333 1.7
Werner syndrome 29 3.15 1.6

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy -1.134 5.3e-06
adult high grade glioma -1.600 4.7e-03
Astrocytoma, Pilocytic -1.600 1.3e-04
atypical teratoid / rhabdoid tumor -1.300 1.9e-04
cystic fibrosis -1.590 2.6e-04
ependymoma -2.100 5.1e-12
glioblastoma -1.800 8.5e-08
group 4 medulloblastoma -1.100 9.7e-03
osteosarcoma -5.166 1.4e-07
primitive neuroectodermal tumor -1.200 1.6e-02
subependymal giant cell astrocytoma -2.142 7.3e-03

 OMIM Phenotype (1)

Protein-protein Interaction (7)

Gene RIF (40)

AA Sequence

MPYSVGFREADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEII      1 - 70
LETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVA     71 - 140
TEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPL    141 - 210
HIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAA    211 - 280
RNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGH    281 - 350
HRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIV    351 - 420
KNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLL    421 - 490
ENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDA    491 - 560
HPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANA    561 - 630
ESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRM    631 - 700
GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTP    701 - 770
LAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEE    771 - 840
KELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVH    841 - 910
TGFLVSFMVDARGGSMRGSRHNGLRVVIPPRTCAAPTRITCRLVKPQKLSTPPPLAEEEGLASRIIALGP    911 - 980
TGAQFLSPVIVEIPHFASHGRGDRELVVLRSENGSVWKEHRSRYGESYLDQILNGMDEELGSLEELEKKR    981 - 1050
VCRIITTDFPLYFVIMSRLCQDYDTIGPEGGSLKSKLVPLVQATFPENAVTKRVKLALQAQPVPDELVTK   1051 - 1120
LLGNQATFSPIVTVEPRRRKFHRPIGLRIPLPPSWTDNPRDSGEGDTTSLRLLCSVIGGTDQAQWEDITG   1121 - 1190
TTKLVYANECANFTTNVSARFWLSDCPRTAEAVNFATLLYKELTAVPYMAKFVIFAKMNDPREGRLRCYC   1191 - 1260
MTDDKVDKTLEQHENFVEVARSRDIEVLEGMSLFAELSGNLVPVKKAAQQRSFHFQSFRENRLAMPVKVR   1261 - 1330
DSSREPGGSLSFLRKAMKYEDTQHILCHLNITMPPCAKGSGAEDRRRTPTPLALRYSILSESTPGSLSGT   1331 - 1400
EQAEMKMAVISEHLGLSWAELARELQFSVEDINRIRVENPNSLLEQSVALLNLWVIREGQNANMENLYTA   1401 - 1470
LQSIDRGEIVNMLEGSGRQSRNLKPDRRHTDRDYSLSPSQMNGYSSLQDELLSPASLGCALSSPLRADQY   1471 - 1540
WNEVAVLDAIPLAATEHDTMLEMSDMQVWSAGLTPSLVTAEDSSLECSKAEDSDATGHEWKLEGALSEEP   1541 - 1610
RGPELGSLELVEDDTVDSDATNGLIDLLEQEEGQRSEEKLPGSKRQDDATGAGQDSENEVSLVSGHQRGQ   1611 - 1680
ARITHSPTVSQVTERSQDRLQDWDADGSIVSYLQDAAQGSWQEEVTQGPHSFQGTSTMTEGLEPGGSQEY   1681 - 1750
EKVLVSVSEHTWTEQPEAESSQADRDRRQQGQEEQVQEAKNTFTQVVQGNEFQNIPGEQVTEEQFTDEQG   1751 - 1820
NIVTKKIIRKVVRQIDLSSADAAQEHEEVTVEGPLEDPSELEVDIDYFMKHSKDHTSTPNP            1821 - 1881
//

Text Mined References (93)

PMID Year Title