Property Summary

NCBI Gene PubMed Count 18
PubMed Score 23.53
PubTator Score 13.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3098 7.2e-94
lung adenocarcinoma 2714 8.2e-22
psoriasis 6685 2.1e-02
Disease Target Count Z-score Confidence
Glaucoma 135 3.625 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.900 2.1e-02
lung adenocarcinoma -1.300 8.2e-22
Breast cancer -1.800 7.2e-94

Gene RIF (5)

PMID Text
25854806 ANGPTL7 is markedly down regulated in metastatic liver cancer.
25622036 ANGPTL7, which is abundantly expressed in keratocytes, plays a major role in maintaining corneal avascularity and transparency.
24903490 Angiopoietin-like 7 is a novel pro-angiogenetic factor over-expressed in cancer
21199193 Together with previous findings, these properties strengthen ANGPTL7's candidacy for the regulation of intraocular pressure and glaucoma.
18421092 Induction of ANGPTL7 secretion by glaucoma stimuli and increased concentration of ANGPTL7 in glaucomatous AH suggest that ANGPTL7 is overexpressed in glaucoma.

AA Sequence

MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQ      1 - 70
ERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYR     71 - 140
ISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIH    141 - 210
RLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDN    211 - 280
CLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP        281 - 346
//

Text Mined References (19)

PMID Year Title
25854806 2015 Cd11b(+) myeloid cells support hepatic metastasis through down-regulation of angiopoietin-like 7 in cancer cells.
25622036 2015 Angiopoietin-like 7 is an anti-angiogenic protein required to prevent vascularization of the cornea.
24903490 2014 Angiopoietin-like 7, a novel pro-angiogenetic factor over-expressed in cancer.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21199193 2011 Evidence for a role of angiopoietin-like 7 (ANGPTL7) in extracellular matrix formation of the human trabecular meshwork: implications for glaucoma.
18421092 2008 Angiopoietin-like 7 secretion is induced by glaucoma stimuli and its concentration is elevated in glaucomatous aqueous humor.
17695521 Effect of CDT6 on factors of angiogenic balance in tumour cell lines.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11682471 2002 The angiopoietin-like factor cornea-derived transcript 6 is a putative morphogen for human cornea.
11426320 2001 The human gene for mannan-binding lectin-associated serine protease-2 (MASP-2), the effector component of the lectin route of complement activation, is part of a tightly linked gene cluster on chromosome 1p36.2-3.
9727400 1998 Molecular cloning of a new angiopoietinlike factor from the human cornea.
8144038 1994 The thiol-specific antioxidant protein from human brain: gene cloning and analysis of conserved cysteine regions.
8026862 1994 Cloning and sequence analysis of candidate human natural killer-enhancing factor genes.