Property Summary

NCBI Gene PubMed Count 18
PubMed Score 154.18
PubTator Score 37.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.229 1.8e-05
pancreatic ductal adenocarcinoma liver m... -1.445 2.9e-03

Gene RIF (12)

PMID Text
26189599 Serum ANGPTL6 levels increased in patients with a hypothyroid status, and both TSH and free T4 levels are associated with ANGPLT6 levels, suggesting a possible association between thyroid function and ANGPTL6 levels.
25011017 AGF concentrations is significantly higher in patients with type 2 diabetes as compared to controls.
23905605 In the second trimester, Angptl6 levels are higher in women with subsequent pregnancy-induced hypertension.
23718665 There are no significant differences in maternal Angptl6/ARP5 serum level between pre-eclamptic women and normally pregnant control women
23070965 Interaction between alpha6 integrin and E-cadherin drives liver metastasis of colorectal cancer cells through hepatic angiopoietin-like 6.
22406517 Serum AGF levels are significantly higher in subjects with polycystic ovary syndrome than those in the healthy control group.
21460784 ANGPTL6 affects resting metabolic rate (RMR), significantly improves lipid profile and slightly improves insulin levels and insulin sensitivity, as well.
20673930 serum AGF levels were paradoxically increased in metabolic syndrome, in comparison with data from animal experiments and data on sex, age, and waist circumference
19447061 study of associations between ANGPTL6 polymorphisms and metabolic syndrome or related phenotypes in a French population
16806062 Our results strongly suggest that AGF is an integrin ligand as well as a mitogenic growth factor and theoretically participates in cutaneous wound healing in a more complex mechanism.
14764539 showed that AGF is a secreted protein, AGF directly promotes chemotactic activity of vascular endothelial cells, and AGF directly induces a permeability change in the local vasculature.
12871997 findings suggest that AGF affects epidermal proliferation and thereby plays a role in the wound healing process

AA Sequence

MGKPWLRALQLLLLLGASWARAGAPRCTYTFVLPPQKFTGAVCWSGPASTRATPEAANASELAALRMRVG      1 - 70
RHEELLRELQRLAAADGAVAGEVRALRKESRGLSARLGQLRAQLQHEAGPGAGPGADLGAEPAAALALLG     71 - 140
ERVLNASAEAQRAAARFHQLDVKFRELAQLVTQQSSLIARLERLCPGGAGGQQQVLPPPPLVPVVPVRLV    141 - 210
GSTSDTSRMLDPAPEPQRDQTQRQQEPMASPMPAGHPAVPTKPVGPWQDCAEARQAGHEQSGVYELRVGR    211 - 280
HVVSVWCEQQLEGGGWTVIQRRQDGSVNFFTTWQHYKAGFGRPDGEYWLGLEPVYQLTSRGDHELLVLLE    281 - 350
DWGGRGARAHYDGFSLEPESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGGWWY    351 - 420
HACAHSNLNGVWHHGGHYRSRYQDGVYWAEFRGGAYSLRKAAMLIRPLKL                        421 - 470
//

Text Mined References (21)

PMID Year Title
26189599 2015 Influence of thyroid dysfunction on serum levels of angiopoietin-like protein 6.
25011017 2014 Relationship between serum levels of angiopoietin-related growth factor and metabolic risk factors.
23905605 2013 Elevated serum angiopoietin-like protein 6 in women with subsequent pregnancy-induced hypertension: a preliminary study.
23718665 2013 Alterations of angiopoietin-related growth factor (Angptl6) during pregnancy and in pre-eclampsia.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23070965 2012 A complex of ?6 integrin and E-cadherin drives liver metastasis of colorectal cancer cells through hepatic angiopoietin-like 6.
22406517 2012 Serum levels of angiopoietin-related growth factor (AGF) are increased in polycystic ovary syndrome.
21460784 2011 Evidence of a role of ANGPTL6 in resting metabolic rate and its potential application in treatment of obesity.
20673930 2011 Serum levels of angiopoietin-related growth factor are increased in metabolic syndrome.
19447061 2009 Association between angiopoietin-like 6 (ANGPTL6) gene polymorphisms and metabolic syndrome-related phenotypes in the French MONICA Study.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
16806062 2006 Angiopoietin-related growth factor (AGF) supports adhesion, spreading, and migration of keratinocytes, fibroblasts, and endothelial cells through interaction with RGD-binding integrins.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14764539 2004 Angiopoietin-related growth factor (AGF) promotes angiogenesis.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12871997 2003 Angiopoietin-related growth factor (AGF) promotes epidermal proliferation, remodeling, and regeneration.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.