Property Summary

NCBI Gene PubMed Count 144
PubMed Score 297.98
PubTator Score 205.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -3.200 2.6e-07
psoriasis 2.200 3.1e-05
glioblastoma -1.400 1.7e-02
group 4 medulloblastoma -2.700 3.4e-07
atypical teratoid/rhabdoid tumor -1.800 2.6e-05
medulloblastoma, large-cell -3.000 2.2e-07
primitive neuroectodermal tumor -1.900 1.0e-03
intraductal papillary-mucinous adenoma (... -1.900 2.4e-04
intraductal papillary-mucinous carcinoma... -1.300 3.0e-03
breast carcinoma -2.400 1.0e-03
fibroadenoma -2.900 2.6e-03
pediatric high grade glioma -1.500 1.8e-03
pilocytic astrocytoma -1.200 4.7e-03
posterior fossa group B ependymoma -1.400 5.9e-04
Breast cancer -1.600 5.0e-12
ductal carcinoma in situ -1.600 2.9e-03
invasive ductal carcinoma -1.800 1.3e-02
ulcerative colitis 1.100 1.9e-04

 IMPC Phenotype (1)

Protein-protein Interaction (8)

Gene RIF (108)

PMID Text
27053616 Knockdown of ANGPTL4 inhibits proliferation and promotes apoptosis in cervical cancer.
26934567 We found that carriers of loss-of-function mutations in ANGPTL4 had triglyceride levels that were lower than those among noncarriers; these mutations were also associated with protection from coronary artery disease.
26933753 Carriers of E40K and other inactivating mutations in ANGPTL4 had lower levels of triglycerides and a lower risk of coronary artery disease than did noncarriers.
26813452 circulating ANGPTL4 levels are up-regulated in COPD patients, and have correlations with pulmonary function and systematic inflammation in COPD
26745120 ANGPTL4 mRNA expressions and serum levels were significantly higher in high grade breast carcinoma.
26546816 Collectively, our findings indicate that miR-134 may regulate lipid accumulation and proinfiammatory cytokine secretion in macrophages by targeting the ANGPTL4 gene.
26417691 ANGPTL4 might promote metastasis and might inhibit apoptosis of colorectal cancer cells by up-regulation of BMP7.
26363050 A1AT binds to FA, and it is this form of A1AT that induces Angptl4 and FABP4 expression via a PPAR-dependent pathway.
26291814 ANGPTL4 levels were higher in both obese and non-obese PCOS patients compared to healthy controls.
26039997 results suggest targeting both ANGPTL4 and VEGF may be necessary for effective treatment or prevention of PDR and provide the foundation for studies evaluating aqueous ANGPTL4 as a biomarker to help guide individualized therapy for diabetic eye disease
25809481 ANGPTL4 can both bind and inactivate lipoprotein lipase (LPL) complexed to GPIHBP1 and inactivation of LPL by ANGPTL4 greatly reduces the affinity of LPL for GPIHBP1
25687026 The ANGPTL4 may be a candidate target in diabetic macular edema treatment and a biomarker of ischemic-induced retinopathy, including diabetic retinopathy.
25597500 Data suggest that up-regulation of plasma levels of Angptl4 (angiopoietin-like 4 protein) and LPL (lipoprotein lipase) can be used as biomarkers specific to detecting the stage of diabetic cardiovascular complications.
25463098 plasma ANGPTL4 levels as well as ANGPTL4 variants significantly predict cardiovascular events independently of conventional cardiovascular risk factors
25424436 This study is the first to show that podocyte-secreted Angptl4 is upregulated in diabetic neuropathy and can be detected in urine.
25289668 High serum ANGPTL4 with circulating RANKL suggests that ANGPTL4 may represent a novel marker for bone destruction in rheumatoid arthritis.
25148701 Hepatocellular carcinoma (HCC) tissues expressed significantly lower levels of ANGPTL4 mRNA than non-tumor tissues; copy number of ANGPTL4 gene in tumor tissues was significantly lower than in non-tumor tissues of HCC patients. Higher frequency of methylation of CpG sites of ANGPTL4 promoter was detected in tumor tissues compared to non-tumor tissues.
25060575 results demonstrate ANGPTL4 contributes to OSCC metastasis by stimulating cell invasion. ANGPTL4 is potential therapeutic target for preventing cancer metastasis.
24854282 These studies reveal that modifying sialylation of the soluble glycoprotein angiopoietin-like 4 or changing key amino acids in its sequence can be used successfully to treat proteinuria.
24815769 Letter: Angiopoietin-like 4 is induced during sebocyte differentiation and regulates sebaceous lipogenesis in vitro but is dispensable for sebaceous gland function in vivo.
24626437 ANGPTL4 is strongly negatively associated with low-density lipoprotein cholesterol and high-density lipoprotein cholesterol and positively with multiple features of the metabolic syndrome including triglycerides.
24591600 Fatty acid-inducible ANGPTL4 governs lipid metabolic response to exercise.
24505142 During chondrogenic differentiation of mesenchymal stem cells, angiopoietin-like 4 (ANGPTL4) triggers degradation and reduced synthesis of the cartilage matrix.
24324678 ANGPTL4 is known to stimulate lipolysis in adults, but does not appear to mediate the increased activity in spontaneous vaginal delivery, indicating the presence of different regulatory inputs.
24317117 Circulating angiopoietin-like 4 links proteinuria with hypertriglyceridemia in nephrotic syndrome.
24141811 The ANGPTL4 is produced by entero-endocrine cells (EEC) in human intestine and expression may be regulated by short chain fatty acids and bile acids.
24114199 The Semaphorin 4D-Plexin-B1-RhoA signaling axis recruits pericytes and regulates vascular permeability through endothelial production of PDGF-B and ANGPTL4.
24075588 In high-calcified plaques, ANGPTL4 might be upregulated for antiangiogenic modulating function together with the downregulation of FGFR2, contributing to the stability of the plaques.
23959876 Data indicate that patients with diabetic eye disease shows that HIF-1alpha and ANGPTL4 localize to ischemic Muller cells.
23925665 ANGPTL4 upregulation may play an important role in ESCC development.
23640487 Angptl4 suppresses foam cell formation to reduce atherosclerosis development.
23617883 EGFRvIII induces Angptl4 expression through the ERK/c-Myc pathway and promotes tumor angiogenesis in malignant gliomas.
23387337 ANGPTL4 was induced by high glucose in RPE cells and exhibited potent angiogenic activity on RE cells.
23339868 At concentrations required for PPARgamma activation and ANGPTL4 induction in colon adenocarcinoma cells.
23283507 Data suggest that plasma ANGPTL4 level can be modulated by dietary factors; healthy subjects and patients with type 2 diabetes underwent dietary restrictions that up-regulated plasma ANGPTL4.
23208498 A PPARbeta/delta-ANGPTL4 pathway is involved in the regulation of tumor cell invasion.
23183503 No association was observed between polymorphisms within the HNF1-alpha and ANGPTL4 genes and the risk of acute coronary syndrome in the Czech population.
23056264 Findings suggest that fatty acids (FAs)-PPARdelta/RXR-Angptl4 axis controls the lipoprotein lipase (LPL)-dependent uptake of FAs in myotubes.
22972030 Data suggest that insulin lowers plasma ANGPTL4 levels by lowering nonesterified fatty acids and by inhibiting ANGPTL4 expression and release from liver cells; glucocorticoids counteract insulin-mediated suppression of ANGPTL4.
22820186 inactivation of LPL in THP-1 macrophages primarily occurs on the cell surface where oligomers of ANGPTL4 are formed.
22773878 Fatty acids bind tightly to the N-terminal domain of angiopoietin-like protein 4 and modulate its interaction with lipoprotein lipase.
22729570 AKT3, ANGPTL4, eNOS3, and VEGFA associations with high altitude sickness in Han and Tibetan Chinese at the Qinghai-Tibetan Plateau
22661548 Studies indicate ANGPTL4 as a promising candidate for clinical intervention in the fight against cancer.
22639947 Angptls would be useful in instances where there is a need to maintain HSCs ex vivo, such as during transduction for gene therapy applications
22549372 Colorectal cancer is associated with lower preoperative plasma ANGPTL4 levels compared with benign colon disease, and the levels may vary inversely with disease severity.
22462789 Health issues associated with ANGPTL4 expression, including obesity, Type 2 diabetes, cardiovascular diseases and cancer. [Review]
22458843 ANGPTL4 interacts and activates specific integrins to facilitate wound healing, modulates vascular permeability, and regulates ROS (reactive oxygen species) level to promote tumorigenesis. [Review]
22307217 overexpression of Angptl4 may promote invasion and metastasis in Colorectal cancer (CRC).
22086875 Hypoxic induction of transgenic angiopoietin-like protein 4 (ANGPTL4) might modulate vascular damage, infarct size, and no-reflow
22078753 ANGPTL4 expression in adipose tissue to insulin was severely blunted in both type 2 diabetes mellitus and older control subjects
21966511 Data showed that PPARbeta/delta regulates epidermal maturation via ANGPTL4-mediated signalling pathway.
21937683 PGE(2) plays an important role in promoting cancer cell proliferation via ANGPTL4 under hypoxic conditions.
21860410 inhibition of HIF-1 activity in BrCa cells inhibits primary tumor growth and metastasis of BrCa cells to the lungs by blocking expression of angiopoietin-like 4 (ANGPTL4) and L1 cell adhesion molecule (L1CAM);ANGPTL4 inhibits endothelial cell(EC)-EC interaction; L1CAM increases the adherence of BrCa cells to ECs
21714923 the ANGPTL4 E40K and T266M variants are associated with lower triglyceride levels in the setting of type 2 diabetes
21709421 expression and secretion of ANGPTL4 by human adipocytes is upregulated by both hypoxia and fatty acids. The stimulatory effect of fatty acids on ANGPTL4 production is augmented under hypoxic conditions
21674552 ANGPTL4 is a target gene of HIF-1alpha and acts as an important regulator in the metastasis of hepatocellular carcinoma.
21596930 Serum angiopoietin-like 4 protein levels and expression in adipose tissue are inversely correlated with obesity in monozygotic twins.
21518214 Bacteria modulate FIAF expression in gut epithelial cell lines. Short chain fatty acids also stimulate FIAF expression.
21489049 Angptl4 is a novel methylation-silenced gene both in rat and human mammary carcinomas.
21398697 the cleavage of ANGPTL4 by these PCs modulates its inhibitory effect on LPL activity.
21397862 Data show that that elevated ANGPTL4 expression is widespread in tumors, and its suppression impairs tumor growth associated with enhanced apoptosis.
21308352 High ANGPTL4 is associated with olorectal cancer venous invasion and distant metastasis.
21217681 Podocyte injury in minimal change disease causes increased expression and secretion of ANGPTL4 in humans.
21212665 A synonymous SNP in ANGPTL4 and haplotypes carrying it are associated with risk of brain arteriovenous malformations (BAVM) but not with intracranial hemorrhage presentation in BAVM cases.
20972945 Serum Angptl4 levels are significantly increased in end-stage renal disease.
20927337 Decreased fat storage by Lactobacillus paracasei is associated with increased levels of ANGPTL4.
20829508 Angptl4 plays a role in in triglyceride metabolism and coronary heart disease risk.
20829508 Observational study of gene-disease association. (HuGE Navigator)
20729546 ANGPTL4 interacts with vitronectin and fibronectin in the wound bed, delaying their proteolytic degradation by metalloproteinases.
20667978 Results demonstrate that HIF is sufficient to enhance osteoclast-mediated bone resorption and that ANGPTL4 can compensate for HIF-1alpha deficiency with respect to stimulation of osteoclast activity and augments osteoblast proliferation and differentiation.
20664963 Suggest that the ANGPTL4 is one of the factors involved in the venous invasion and metastasis of human gastric cancer.
20660728 vGPCR up-regulation of ANGPTL4 plays a prominent role in promoting the angiogenesis and vessel permeability observed in Kaposi's sarcoma
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20595396 Data show that PPARbeta/delta and transforming growth factor-beta (TGFbeta) pathways functionally interact with each other and synergistically induce ANGPTL4 transcription.
20454689 Angptl4 mRNA expression was highly associated with ccRCC; moreover, angptl4 mRNA allows to discriminate the renal origin of metastases of clear-cell carcinomas arising from various organs
20162021 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19890028 Our data also suggest possible associations between ANGPTL4 polymorphisms and body fat
19890028 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19878569 Observational study of gene-disease association. (HuGE Navigator)
19826106 Data suggest roles for ANGPTL4 and ANGPTL3 in modulation of serum TG and HDL levels in obesity in a Finnish population sample.
19628874 ANGPTL4 is a direct GR target that participates in glucocorticoid-regulated triglyceride metabolism.
19542565 Like ANGPTL4, ANGPTL3 inhibited nonstabilized LPL but not GPIHBP1-stabilized LPL
19342599 Caloric restriction and exercise increase plasma ANGPTL4 levels in humans via elevated free fatty acids.
19270337 Genetic variation in ANGPTL4 provides insights into protein processing and function.
19246456 the 12-amino acid consensus motif within the CCD of Angptl4, especially the three polar residues within this motif, is responsible for its interaction with and inhibition of LPL by blocking the enzyme dimerization.
19074989 ANGPTL4 is produced by human myotubes in response to long chain fatty acids via PPAR-delta.
19060906 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19028676 The finding that ANGPTL3 and ANGPTL4 inhibit LPL activity through distinct mechanisms indicates that the two proteins play unique roles in modulation of lipid metabolism in vivo.
19019854 The coiled-coil domain of ANGPTL4 is required for the protein to fulfill its antiangiogeneic activity function.
18974381 Although associated with an atheroprotective lipid profile, E40K was associated with increased CHD risk, suggesting Angptl4 influences parameters beyond lipid levels. T266M showed effects only under conditions of postprandial stress.
18940399 the 40K variant of ANGPTL4 appeared to confer reduced genetic risk for CHD.
18940399 Observational study of gene-disease association. (HuGE Navigator)
18809343 triglyceride concentration differences among adipokine angiopoietin-like 4 (ANGPTL4[E40K]) A allele carriers and G allele homozygotes are maintained over time; degree of triglyceride increase was similar between groups and not modified by weight changes
18809343 Observational study of gene-disease association. (HuGE Navigator)
18634015 Hypoxia upregulates the expression of angiopoietin-like-4 in human articular chondrocytes: role of angiopoietin-like-4 in the expression of matrix metalloproteinases MMP1 and MMP3 and cartilage degradation
18599063 ANGPTL4 has a role in HDL-cholesterol and triglyceride concentrations in white men
18442626 common genetic variation within the ANGPTL4 gene may not play a major role in the development of prediabetic phenotypes in our white population.
18442626 Observational study of gene-disease association. (HuGE Navigator)
18433990 Microarray expression profile reveals the change of molecules involved in the synoikis-like hepatoma cells and our data indicated that ANGPTL4 contributed to anoikis resistance of hepatoma cells.
18394990 TGFbeta induction of Angptl4 in cancer cells that are about to enter the circulation enhances their subsequent retention in the lungs, but not in the bone.
17322881 Resequencing of ANGPTL4 in a multiethnic population allowed analysis of the phenotypic effects.
17049073 Our hypothesis that variations of pO2 could exist between adipose tissue from anatomical origins was supported by staining of the hypoxic-induced angiopoietin ANGPTL4 depended on the location of fat.
16531751 Angptl4 plays important roles in lipoprotein lipase activity in both fed and fasted states
16081640 Angptl4 transgenic mice displayed elevated plasma triglycerides and reduced postheparin plasma lipoprotein lipase(LPL). Recombinant Angptl4 inhibited mouse LPL and recombinant human LPL activity in vitro.
15190076 FIAF (angiopoietin-like 4 protein) may partially exert its function via a truncated form.
12707035 This protein is a proangiogenic factor produced during ischemia and in conventional renal cell carcinoma.
12707035 a link between metabolic disorders and hypoxia-induced angiogenesis.

AA Sequence

MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALE      1 - 70
RRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHL     71 - 140
QSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSP    141 - 210
PFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDW    211 - 280
DGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWW    281 - 350
FGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS                  351 - 406
//

Text Mined References (146)

PMID Year Title
27053616 2016 [Knockdown of angiopoietin-like protein 4 inhibits proliferation and promotes apoptosis in cervical cancer SiHa cells].
26934567 2016 Coding Variation in ANGPTL4, LPL, and SVEP1 and the Risk of Coronary Disease.
26933753 2016 Inactivating Variants in ANGPTL4 and Risk of Coronary Artery Disease.
26813452 2016 Serum angiopoietin-like 4 is over-expressed in COPD patients: association with pulmonary function and inflammation.
26745120 2015 Significance of Tissue Expression and Serum Levels of Angiopoietin-like Protein 4 in Breast Cancer Progression: Link to NF-?B /P65 Activity and Pro-Inflammatory Cytokines.
26546816 2016 MicroRNA-134 actives lipoprotein lipase-mediated lipid accumulation and inflammatory response by targeting angiopoietin-like 4 in THP-1 macrophages.
26417691 2015 Angiopoietin-like 4 enhances metastasis and inhibits apoptosis via inducing bone morphogenetic protein 7 in colorectal cancer cells.
26363050 2015 ?1-Antitrypsin Combines with Plasma Fatty Acids and Induces Angiopoietin-like Protein 4 Expression.
26291814 2015 Examination of angiopoietin-like protein 4, neuropeptide Y, omentin-1 levels of obese and non-obese patients with polycystic ovary syndrome.
26039997 2015 Angiopoietin-like 4 is a potent angiogenic factor and a novel therapeutic target for patients with proliferative diabetic retinopathy.
25809481 2015 Angiopoietin-like 4 Modifies the Interactions between Lipoprotein Lipase and Its Endothelial Cell Transporter GPIHBP1.
25687026 2015 Aqueous Levels of Angiopoietin-like 4 and Semaphorin 3E Correlate with Nonperfusion Area and Macular Volume in Diabetic Retinopathy.
25597500 2015 Lipoprotein lipase and angiopoietin-like 4 - Cardiomyocyte secretory proteins that regulate metabolism during diabetic heart disease.
25463098 2014 Angiopoietin-like protein 4 significantly predicts future cardiovascular events in coronary patients.
25424436 2015 Upregulation of podocyte-secreted angiopoietin-like-4 in diabetic nephropathy.
25289668 2014 Angiopoietin-like 4 is over-expressed in rheumatoid arthritis patients: association with pathological bone resorption.
25148701 2014 Clinical relevance and therapeutic potential of angiopoietin-like protein 4 in hepatocellular carcinoma.
25060575 2015 ANGPTL4 regulates the metastatic potential of oral squamous cell carcinoma.
24854282 2014 Nephrotic syndrome: components, connections, and angiopoietin-like 4-related therapeutics.
24815769 2014 Angiopoietin-like 4, a protein strongly induced during sebocyte differentiation, regulates sebaceous lipogenesis but is dispensable for sebaceous gland function in vivo.
24626437 2014 Differential association of plasma angiopoietin-like proteins 3 and 4 with lipid and metabolic traits.
24591600 2014 Fatty acid-inducible ANGPTL4 governs lipid metabolic response to exercise.
24505142 2014 Involvement of angiopoietin-like 4 in matrix remodeling during chondrogenic differentiation of mesenchymal stem cells.
24324678 2013 Lack of relationship between cord serum angiopoietin-like protein 4 (ANGPTL4) and lipolytic activity in human neonates born by spontaneous delivery.
24317117 2014 Circulating angiopoietin-like 4 links proteinuria with hypertriglyceridemia in nephrotic syndrome.
24141811 2014 ANGPTL4 is produced by entero-endocrine cells in the human intestinal tract.
24114199 2014 The Semaphorin 4D-Plexin-B1-RhoA signaling axis recruits pericytes and regulates vascular permeability through endothelial production of PDGF-B and ANGPTL4.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24075588 Upregulation of ANGPTL4 messenger RNA and protein in severely calcified carotid plaques.
23960078 2013 Angiopoietin-like protein 4 inhibition of lipoprotein lipase: evidence for reversible complex formation.
23959876 2013 Hypoxic retinal Muller cells promote vascular permeability by HIF-1-dependent up-regulation of angiopoietin-like 4.
23925665 2013 Clinical significance of angiopoietin-like protein 4 expression in tissue and serum of esophageal squamous cell carcinoma patients.
23640487 2013 Overexpression of angiopoietin-like protein 4 protects against atherosclerosis development.
23617883 2013 Epidermal growth factor receptor variant type III markedly accelerates angiogenesis and tumor growth via inducing c-myc mediated angiopoietin-like 4 expression in malignant glioma.
23518684 2013 ANGPTL4 expression induced by butyrate and rosiglitazone in human intestinal epithelial cells utilizes independent pathways.
23387337 2013 Angiopoietin-like protein 4 (ANGPTL4) is induced by high glucose in retinal pigment epithelial cells and exhibits potent angiogenic activity on retinal endothelial cells.
23339868 2013 Short-chain fatty acids stimulate angiopoietin-like 4 synthesis in human colon adenocarcinoma cells by activating peroxisome proliferator-activated receptor ?.
23319744 2013 Omega-3 long-chain fatty acids strongly induce angiopoietin-like 4 in humans.
23283507 2013 Dietary modulation of plasma angiopoietin-like protein 4 concentrations in healthy volunteers and in patients with type 2 diabetes.
23208498 2013 Inverse PPAR?/? agonists suppress oncogenic signaling to the ANGPTL4 gene and inhibit cancer cell invasion.
23183503 2012 Variants within HNF1? and ANGPTL4 genes and acute coronary syndrome in Czech population. The GENDEMIP study.
23056264 2012 Angiopoietin-like 4 mediates PPAR delta effect on lipoprotein lipase-dependent fatty acid uptake but not on beta-oxidation in myotubes.
22972030 2012 Angiopoietin-like protein 4 is differentially regulated by glucocorticoids and insulin in vitro and in vivo in healthy humans.
22820186 2012 Inactivation of lipoprotein lipase occurs on the surface of THP-1 macrophages where oligomers of angiopoietin-like protein 4 are formed.
22791755 2012 Ethinyl estradiol-cyproterone acetate versus low-dose pioglitazone-flutamide-metformin for adolescent girls with androgen excess: divergent effects on CD163, TWEAK receptor, ANGPTL4, and LEPTIN expression in subcutaneous adipose tissue.
22773878 2012 Fatty acids bind tightly to the N-terminal domain of angiopoietin-like protein 4 and modulate its interaction with lipoprotein lipase.
22732211 2012 Triacylglycerol-rich lipoproteins protect lipoprotein lipase from inactivation by ANGPTL3 and ANGPTL4.
22729570 2012 AKT3, ANGPTL4, eNOS3, and VEGFA associations with high altitude sickness in Han and Tibetan Chinese at the Qinghai-Tibetan Plateau.
22661548 2012 Emerging roles of angiopoietin-like 4 in human cancer.
22639947 2012 Angptl4 maintains in vivo repopulation capacity of CD34+ human cord blood cells.
22549372 2012 Plasma levels of angiopoietin-like protein 4 (ANGPTL4) are significantly lower preoperatively in colorectal cancer patients than in cancer-free patients and are further decreased during the first month after minimally invasive colorectal resection.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22462789 2012 Angiopoietin-like protein 4: health effects, modulating agents and structure-function relationships.
22458843 2012 Angiopoietin-like 4: a decade of research.
22307217 2012 Mechanisms involved in biological behavior changes associated with Angptl4 expression in colon cancer cell lines.
22086875 2012 Protection against myocardial infarction and no-reflow through preservation of vascular integrity by angiopoietin-like 4.
22078753 2012 Effects of hyperinsulinemia on lipoprotein lipase, angiopoietin-like protein 4, and glycosylphosphatidylinositol-anchored high-density lipoprotein binding protein 1 in subjects with and without type 2 diabetes mellitus.
21966511 2011 Angiopoietin-like 4 regulates epidermal differentiation.
21937683 2011 ANGPTL4 induction by prostaglandin E2 under hypoxic conditions promotes colorectal cancer progression.
21860410 2012 HIF-1-dependent expression of angiopoietin-like 4 and L1CAM mediates vascular metastasis of hypoxic breast cancer cells to the lungs.
21841165 2011 ANGPTL4 modulates vascular junction integrity by integrin signaling and disruption of intercellular VE-cadherin and claudin-5 clusters.
21714923 2011 ANGPTL4 variants E40K and T266M are associated with lower fasting triglyceride levels in Non-Hispanic White Americans from the Look AHEAD Clinical Trial.
21709421 2011 Fatty acids and hypoxia stimulate the expression and secretion of the adipokine ANGPTL4 (angiopoietin-like protein 4/ fasting-induced adipose factor) by human adipocytes.
21674552 2011 Hypoxia-inducible factor 1 alpha-activated angiopoietin-like protein 4 contributes to tumor metastasis via vascular cell adhesion molecule-1/integrin ?1 signaling in human hepatocellular carcinoma.
21596930 2011 Serum angiopoietin-like 4 protein levels and expression in adipose tissue are inversely correlated with obesity in monozygotic twins.
21518214 2011 Bacterial monocultures, propionate, butyrate and H2O2 modulate the expression, secretion and structure of the fasting-induced adipose factor in gut epithelial cell lines.
21489049 2011 Methylation silencing of angiopoietin-like 4 in rat and human mammary carcinomas.
21421336 2011 Angiopoietin-like 4: a novel molecular hallmark in oral Kaposi's sarcoma.
21398697 2011 Proteolytic processing of angiopoietin-like protein 4 by proprotein convertases modulates its inhibitory effects on lipoprotein lipase activity.
21397862 2011 Angiopoietin-like 4 protein elevates the prosurvival intracellular O2(-):H2O2 ratio and confers anoikis resistance to tumors.
21308352 2011 Expression of angiopoietin-like 4 (ANGPTL4) in human colorectal cancer: ANGPTL4 promotes venous invasion and distant metastasis.
21217681 2011 Filtering new facts about kidney disease.
21212665 2011 Angiopoietin-like 4 (ANGPTL4) gene polymorphisms and risk of brain arteriovenous malformations.
21151138 2011 Podocyte-secreted angiopoietin-like-4 mediates proteinuria in glucocorticoid-sensitive nephrotic syndrome.
21109191 2010 Angptl4 protects against severe proinflammatory effects of saturated fat by inhibiting fatty acid uptake into mesenteric lymph node macrophages.
20972945 2011 Serum levels of the adipokine fasting-induced adipose factor/angiopoietin-like protein 4 depend on renal function.
20927337 2010 Decreased fat storage by Lactobacillus paracasei is associated with increased levels of angiopoietin-like 4 protein (ANGPTL4).
20829508 2010 The relationship between plasma angiopoietin-like protein 4 levels, angiopoietin-like protein 4 genotype, and coronary heart disease risk.
20729546 2010 Angiopoietin-like 4 interacts with matrix proteins to modulate wound healing.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20667978 2010 Hypoxia-inducible factor regulates osteoclast-mediated bone resorption: role of angiopoietin-like 4.
20664963 2010 Expression of angiopoietin-like 4 in human gastric cancer: ANGPTL4 promotes venous invasion.
20660728 2010 Viral G protein-coupled receptor up-regulates Angiopoietin-like 4 promoting angiogenesis and vascular permeability in Kaposi's sarcoma.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20595396 2010 Transcriptional profiling identifies functional interactions of TGF ? and PPAR ?/? signaling: synergistic induction of ANGPTL4 transcription.
20454689 2010 Determination of angptl4 mRNA as a diagnostic marker of primary and metastatic clear cell renal-cell carcinoma.
20162021 2010 Phylogenetics applied to genotype/phenotype association and selection analyses with sequence data from angptl4 in humans.
20025870 2010 Induction of ANGPTL4 expression in human airway smooth muscle cells by PMA through activation of PKC and MAPK pathways.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19890028 2009 Associations between common genetic polymorphisms in angiopoietin-like proteins 3 and 4 and lipid metabolism and adiposity in European adolescents and adults.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19826106 2010 Quantitation of serum angiopoietin-like proteins 3 and 4 in a Finnish population sample.
19775228 2010 Expression of angiopoietin-like 4 and tenascin C but not cathepsin C mRNA predicts prognosis of oral tongue squamous cell carcinoma.
19628874 2009 Angiopoietin-like 4 (ANGPTL4, fasting-induced adipose factor) is a direct glucocorticoid receptor target and participates in glucocorticoid-regulated triglyceride metabolism.
19542565 2009 GPIHBP1 stabilizes lipoprotein lipase and prevents its inhibition by angiopoietin-like 3 and angiopoietin-like 4.
19342599 2009 Caloric restriction and exercise increase plasma ANGPTL4 levels in humans via elevated free fatty acids.
19318355 2009 Identification of a new functional domain in angiopoietin-like 3 (ANGPTL3) and angiopoietin-like 4 (ANGPTL4) involved in binding and inhibition of lipoprotein lipase (LPL).
19270337 2009 Genetic variation in ANGPTL4 provides insights into protein processing and function.
19246456 2009 A highly conserved motif within the NH2-terminal coiled-coil domain of angiopoietin-like protein 4 confers its inhibitory effects on lipoprotein lipase by disrupting the enzyme dimerization.
19074989 2009 Muscle-derived angiopoietin-like protein 4 is induced by fatty acids via peroxisome proliferator-activated receptor (PPAR)-delta and is of metabolic relevance in humans.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
19028676 2009 The angiopoietin-like proteins ANGPTL3 and ANGPTL4 inhibit lipoprotein lipase activity through distinct mechanisms.
19019854 2009 Interaction of the coiled-coil domain with glycosaminoglycans protects angiopoietin-like 4 from proteolysis and regulates its antiangiogenic activity.
18974381 2008 ANGPTL4 E40K and T266M: effects on plasma triglyceride and HDL levels, postprandial responses, and CHD risk.
18940399 2008 Variation in ANGPTL4 and risk of coronary heart disease: the Atherosclerosis Risk in Communities Study.
18809343 2008 Longitudinal changes in triglycerides according to ANGPTL4[E40K] genotype and longitudinal body weight change in the atherosclerosis risk in communities study.
18728224 2008 Enhanced angiogenesis in obesity and in response to PPARgamma activators through adipocyte VEGF and ANGPTL4 production.
18634015 2009 Hypoxia upregulates the expression of angiopoietin-like-4 in human articular chondrocytes: role of angiopoietin-like-4 in the expression of matrix metalloproteinases and cartilage degradation.
18599063 2009 Carbohydrate intake modifies associations between ANGPTL4[E40K] genotype and HDL-cholesterol concentrations in White men from the Atherosclerosis Risk in Communities (ARIC) study.
18442626 2008 Genetic variation within the ANGPTL4 gene is not associated with metabolic traits in white subjects at an increased risk for type 2 diabetes mellitus.
18433990 2008 Acquisition of anoikis resistance reveals a synoikis-like survival style in BEL7402 hepatoma cells.
18394990 2008 TGFbeta primes breast tumors for lung metastasis seeding through angiopoietin-like 4.
18340008 2008 Suppression of the Raf/MEK/ERK signaling cascade and inhibition of angiogenesis by the carboxyl terminus of angiopoietin-like protein 4.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17322881 2007 Population-based resequencing of ANGPTL4 uncovers variations that reduce triglycerides and increase HDL.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17130448 2006 Angiopoietin-like 4 prevents metastasis through inhibition of vascular permeability and tumor cell motility and invasiveness.
17088546 2006 Angiopoietin-like protein 4 converts lipoprotein lipase to inactive monomers and modulates lipase activity in adipose tissue.
17068295 2006 Extracellular matrix-bound angiopoietin-like 4 inhibits endothelial cell adhesion, migration, and sprouting and alters actin cytoskeleton.
17049073 2006 Is oxygen a key factor in the lipodystrophy phenotype?
16531751 2006 Genetics and regulation of angiopoietin-like proteins 3 and 4.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16272564 2006 The fasting-induced adipose factor/angiopoietin-like protein 4 is physically associated with lipoproteins and governs plasma lipid levels and adiposity.
16081640 2005 Transgenic angiopoietin-like (angptl)4 overexpression and targeted disruption of angptl4 and angptl3: regulation of triglyceride metabolism.
16049480 2005 Genes that mediate breast cancer metastasis to lung.
15870027 2005 Angiopoietin-like-4 is a potential angiogenic mediator in arthritis.
15863837 2005 Differential regulation and properties of angiopoietin-like proteins 3 and 4.
15837923 2005 Angiopoietin-like protein 4 decreases blood glucose and improves glucose tolerance but induces hyperlipidemia and hepatic steatosis in mice.
15579652 2004 Induction of adipocyte-like phenotype in human mesenchymal stem cells by hypoxia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15292369 2004 Oligomerization state-dependent hyperlipidemic effect of angiopoietin-like protein 4.
15284220 2004 Biological characterization of angiopoietin-3 and angiopoietin-4.
15190076 2004 The direct peroxisome proliferator-activated receptor target fasting-induced adipose factor (FIAF/PGAR/ANGPTL4) is present in blood plasma as a truncated protein that is increased by fenofibrate treatment.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14583458 2003 Inhibition of angiogenesis and vascular leakiness by angiopoietin-related protein 4.
14570927 2004 Oligomerization and regulated proteolytic processing of angiopoietin-like protein 4.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12707035 2003 Angiopoietin-like 4 is a proangiogenic factor produced during ischemia and in conventional renal cell carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438262 2002 Identification of silencing of nine genes in human gastric cancers.
12015030 2002 [Expression and function of hepatocellular carcinoma-related gene pp1158].
11953136 2002 [Cloning of a novel gene, ANGPTL4 and the functional study in angiogenesis].
10866690 2000 Peroxisome proliferator-activated receptor gamma target gene encoding a novel angiopoietin-related protein associated with adipose differentiation.
10698685 2000 Hepatic expression, synthesis and secretion of a novel fibrinogen/angiopoietin-related protein that prevents endothelial-cell apoptosis.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.