Property Summary

NCBI Gene PubMed Count 47
PubMed Score 67.92
PubTator Score 48.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
urothelial carcinoma 1.400 1.2e-02
astrocytoma 2.100 2.4e-02
ependymoma 2.000 4.5e-02
oligodendroglioma 2.900 7.5e-03
glioblastoma 2.200 1.5e-05
sonic hedgehog group medulloblastoma 3.100 1.1e-05
cystic fibrosis 1.368 1.5e-04
medulloblastoma, large-cell 1.300 2.2e-02
Duchenne muscular dystrophy 1.056 1.1e-05
autosomal dominant Emery-Dreifuss muscul... 1.283 1.1e-03
limb girdle muscular dystrophy 2A 1.081 1.7e-04
Becker muscular dystrophy 1.406 3.1e-04
adrenocortical carcinoma 1.180 1.9e-03
primary pancreatic ductal adenocarcinoma 2.323 3.0e-04
intraductal papillary-mucinous carcinoma... -1.300 7.3e-04
lung cancer -1.200 2.1e-02
colon cancer -1.100 4.2e-02
breast carcinoma -1.900 5.9e-05
fibroadenoma -2.100 7.2e-03
diabetes mellitus -1.500 1.8e-03
interstitial cystitis 1.700 2.2e-04
pediatric high grade glioma 2.100 4.1e-06
pilocytic astrocytoma 2.500 7.3e-08
lung carcinoma -1.100 5.7e-08
gastric carcinoma 2.000 2.2e-02
ductal carcinoma in situ -1.800 6.6e-03
invasive ductal carcinoma -2.200 7.6e-04
ulcerative colitis 1.900 6.8e-05
ovarian cancer 1.800 4.9e-04
pancreatic cancer 2.400 1.2e-04

Synonym

Accession Q9UKU9 Q5JT58 Q8NCH7
Symbols ARP2
HARP

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (34)

PMID Text
26435501 Angptl2 induces proinflammatory responses in peritoneal macrophages and monocytes.
26420253 Serum ANGPTL2 in GC patients was significantly higher than for healthy controls.
26254352 ANGPTL2 may be a useful marker for detecting early postoperative recurrence in patients with gastric cancer.
26132105 ANGPTL2 promotes adipose tissue macrophage and T lymphocyte accumulation and leads to insulin resistance.
26056041 signaling involving ANGPTL2 and LILRB2 is important for lung cancer development
25999029 these findings are the first to suggest a considerable role for Angptl2 in the pathogenesis of unstable coronary disease in a clinical context
25964566 Serum ANGPTL2 improves preoperative detection of LN metastasis in CRC
25889082 Serum ANGPTL2 concentration was associated with carotid atherosclerosis in patients with type 2 diabetes.
25735609 In lumbar spinal stenosis, Angptl2 promotes inflammation in ligamentum flavum(LF) tissue by activating IL-6 expression, leading to LF degeneration and hypertrophy.
25484242 These results suggested that ANGPTL2 was a potential biomarker for gastric cancer.
25417860 This review aims at presenting an updated description of both the beneficial and deleterious biological properties of angptl2, in addition to its molecular signalling pathways and transcriptional regulation
25370833 ANGPTL2 may be important in the acquisition of androgen independency and tumor progression of prostate cancer in an autocrine and/or paracrine manner via the integrin alpha5beta1 receptor.
25294915 Serum ANGPTL2 is a novel diagnostic and recurrence-predictive biomarker in patients with colorectal cancer.
25287946 Results show that ANGPTL2 antagonizes apoptosis by increasing Syk expression in colorectal cancer cells resistant to chemotherapy.
25174582 abnormal upregulation of ANGPTL2 in colorectal cancer is associated with miR-25 downregulation
24899623 A novel motif in the first and fourth Ig domains of LILRB2 was identified that is necessary for the receptor to be bound and activated by Angptl2.
24585434 Serum ANGPTL2 levels in patients with metastatic breast cancer were significantly higher than those in healthy subjects or in patients with ductal carcinoma in situ or non-metastatic invasive ductal carcinoma.
24563071 ANGPTL2 positively regulates endothelial colony forming cell vascular lumen formation.
24526691 Endothelial cell-derived Angptl2 accelerates vascular inflammation by activating proinflammatory signaling in endothelial cells and increasing macrophage infiltration, leading to endothelial dysfunction and atherosclerosis progression.
24465594 expression of Angptl2 induced by mechanical stress in ligamentus flavum (LF) fibroblasts promotes LF tissue degeneration.
24448647 findings demonstrate that preventing ANGPTL2 signaling stimulated by the tumor microenvironment could inhibit tumor cell migration and metastasis
23739531 Elevated serum Angptl2 is associated with the likelihood of CKD in the general population.
23602322 Angptl2 levels are elevated in patients with type 2 diabetes with an independent association between increasing Angptl2 levels and increasing levels of albuminuria.
23469106 periodic expression of ANGPTL2 is regulated by a molecular clock
23333801 In epicardial adipose tissue from coronary heart disease patients, ANGPTL2 expression was positively correlated with that of TNF-alpha.
22966088 Elevated serum ANGPTL2 levels were positively associated with the development of T2DM in a general population, independent of other risk factors including hs-CRP levels.
22556334 Macrophage-derived Angptl2 contributes to abdominal aortic aneurysm development by inducing inflammation and degradation of extracellular matrix in the vessel wall.
22345152 tumor cell-derived ANGPTL2 drives metastasis and provided an initial proof of concept for blockade of its action as a strategy to antagonize the metastatic process.
22281496 keratinocyte-derived Angptl2 functions in dermatomyositis pathogenesis by inducing chronic inflammation in skin tissue.
21983347 ANGPTL-2 and -3 have enhancing effect on human hematopoietic progenitor cell survival, effects requiring the CC domain of the ANGPTL molecules.
20304962 Angptl2 acts as an important rheumatoid synovium-derived inflammatory mediator in RA pathogenesis
19723494 Angiopoietin-like protein 2 (Angptl2) was secreted by adipose tissue and that its circulating level was closely related to adiposity, systemic insulin resistance, and inflammation in humans.
18593905 epigenetic silencing by hypermethylation of the ANGPTL2 promoter leads to a loss of ANGPTL2 function, which may be a factor in the carcinogenesis of ovarian cancer in a stage-dependent manner.
17347581 The upregulation of ANGPTL2 in diabetic glomerulopathy shows a close relationship to abnormal microvasculature and endothelial inflammation.

AA Sequence

MRPLCVTCWWLGLLAAMGAVAGQEDGFEGTEEGSPREFIYLNRYKRAGESQDKCTYTFIVPQQRVTGAIC      1 - 70
VNSKEPEVLLENRVHKQELELLNNELLKQKRQIETLQQLVEVDGGIVSEVKLLRKESRNMNSRVTQLYMQ     71 - 140
LLHEIIRKRDNALELSQLENRILNQTADMLQLASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQRVPSA    141 - 210
RPVPQPPPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQ    211 - 280
ALEDGHDTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLG    281 - 350
LENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLD    351 - 420
RDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRPNPN    421 - 490
TFH                                                                       491 - 493
//

Text Mined References (48)

PMID Year Title
26435501 2015 Angiopoietin-like protein 2 induces proinflammatory responses in peritoneal cells.
26420253 2015 Serum angiopoietin-like protein 2 as a potential biomarker for diagnosis, early recurrence and prognosis in gastric cancer patients.
26254352 2015 Angiopoietin-like Protein 2 as a Predictor of Early Recurrence in Patients After Curative Surgery for Gastric Cancer.
26132105 2015 Angiopoietin Like Protein 2 (ANGPTL2) Promotes Adipose Tissue Macrophage and T lymphocyte Accumulation and Leads to Insulin Resistance.
26056041 2015 ANGPTL2/LILRB2 signaling promotes the propagation of lung cancer cells.
25999029 2015 Elevated Serum Angiopoietin-like Protein 2 in Patients with Acute Coronary Syndrome.
25964566 2015 Serum Angiopoietin-like Protein 2 Improves Preoperative Detection of Lymph Node Metastasis in Colorectal Cancer.
25889082 2015 Association of serum angiopoietin-like protein 2 with carotid intima-media thickness in subjects with type 2 diabetes.
25735609 2015 Angiopoietin-like protein 2 promotes inflammatory conditions in the ligamentum flavum in the pathogenesis of lumbar spinal canal stenosis by activating interleukin-6 expression.
25484242 2015 Angiopoietin-like protein 2 is a potential biomarker for gastric cancer.
25417860 2014 Angiopoietin-like-2: a multifaceted protein with physiological and pathophysiological properties.
25370833 2015 Angiopoietin-like protein 2 induces androgen-independent and malignant behavior in human prostate cancer cells.
25294915 2014 Elevated serum angiopoietin-like protein 2 correlates with the metastatic properties of colorectal cancer: a serum biomarker for early diagnosis and recurrence.
25287946 2014 Angiopoietin-like protein 2 renders colorectal cancer cells resistant to chemotherapy by activating spleen tyrosine kinase-phosphoinositide 3-kinase-dependent anti-apoptotic signaling.
25174582 2014 Angiopoietin-like protein 2 negatively regulated by microRNA-25 contributes to the malignant progression of colorectal cancer.
24899623 2014 A motif in LILRB2 critical for Angptl2 binding and activation.
24585434 2014 Serum ANGPTL2 levels reflect clinical features of breast cancer patients: implications for the pathogenesis of breast cancer metastasis.
24563071 2014 Angiopoietin-like protein 2 regulates endothelial colony forming cell vasculogenesis.
24526691 2014 Role of endothelial cell-derived angptl2 in vascular inflammation leading to endothelial dysfunction and atherosclerosis progression.
24465594 2014 Angiopoietin-like protein 2 induced by mechanical stress accelerates degeneration and hypertrophy of the ligamentum flavum in lumbar spinal canal stenosis.
24448647 2014 The secreted protein ANGPTL2 promotes metastasis of osteosarcoma cells through integrin ?5?1, p38 MAPK, and matrix metalloproteinases.
23739531 2013 Angiopoietin-like protein 2 is associated with chronic kidney disease in a general Japanese population: the Hisayama Study.
23602322 2013 Serum Angptl2 levels are independently associated with albuminuria in type 2 diabetes.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23469106 2013 A molecular clock regulates angiopoietin-like protein 2 expression.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23333801 2013 Perivascular adipose tissue-secreted angiopoietin-like protein 2 (Angptl2) accelerates neointimal hyperplasia after endovascular injury.
22966088 2013 Angiopoietin-like protein 2 and risk of type 2 diabetes in a general Japanese population: the Hisayama study.
22556334 2012 Macrophage-derived angiopoietin-like protein 2 accelerates development of abdominal aortic aneurysm.
22345152 2012 Tumor cell-derived angiopoietin-like protein ANGPTL2 is a critical driver of metastasis.
22281496 2012 The role of angiopoietin-like protein 2 in pathogenesis of dermatomyositis.
21983347 2012 Angiopoietin-like-2 and -3 act through their coiled-coil domains to enhance survival and replating capacity of human cord blood hematopoietic progenitors.
20304962 2010 Synoviocyte-derived angiopoietin-like protein 2 contributes to synovial chronic inflammation in rheumatoid arthritis.
19723494 2009 Angiopoietin-like protein 2 promotes chronic adipose tissue inflammation and obesity-related systemic insulin resistance.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18593905 2008 Frequent inactivation of a putative tumor suppressor, angiopoietin-like protein 2, in ovarian cancer.
17347581 2007 Enhanced expression of ANGPTL2 in the microvascular lesions of diabetic glomerulopathy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12624729 2003 Identification of a novel human angiopoietin-like gene expressed mainly in heart.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10473614 1999 Molecular cloning, expression, and characterization of angiopoietin-related protein. angiopoietin-related protein induces endothelial cell sprouting.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.