Property Summary

NCBI Gene PubMed Count 57
PubMed Score 80.06
PubTator Score 48.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
adrenocortical carcinoma 1.180 1.9e-03
adult high grade glioma 1.500 1.0e-02
astrocytic glioma 1.600 1.2e-02
Astrocytoma, Pilocytic 2.600 5.7e-08
autosomal dominant Emery-Dreifuss muscul... 1.276 3.3e-03
Becker muscular dystrophy 1.406 3.1e-04
breast carcinoma -1.900 5.9e-05
colon cancer -1.100 4.2e-02
cystic fibrosis 1.368 1.5e-04
diabetes mellitus -1.500 1.8e-03
Duchenne muscular dystrophy 1.056 1.1e-05
ductal carcinoma in situ -1.800 6.6e-03
ependymoma 2.000 4.5e-02
fibroadenoma -2.100 7.2e-03
gastric carcinoma 2.000 2.2e-02
glioblastoma 1.700 1.2e-05
interstitial cystitis 1.700 2.2e-04
intraductal papillary-mucinous carcinoma... -1.300 7.3e-04
invasive ductal carcinoma -2.100 9.4e-04
limb girdle muscular dystrophy 2A 1.081 1.7e-04
lung cancer -1.200 2.1e-02
lung carcinoma -1.100 5.7e-08
medulloblastoma 1.600 1.5e-02
medulloblastoma, large-cell 1.300 2.2e-02
oligodendroglioma 2.700 8.4e-03
ovarian cancer -1.500 1.7e-07
pancreatic cancer 2.400 1.2e-04
primary pancreatic ductal adenocarcinoma 2.323 3.0e-04
ulcerative colitis 1.900 6.8e-05
urothelial carcinoma 1.400 1.2e-02

Gene RIF (44)

AA Sequence

MRPLCVTCWWLGLLAAMGAVAGQEDGFEGTEEGSPREFIYLNRYKRAGESQDKCTYTFIVPQQRVTGAIC      1 - 70
VNSKEPEVLLENRVHKQELELLNNELLKQKRQIETLQQLVEVDGGIVSEVKLLRKESRNMNSRVTQLYMQ     71 - 140
LLHEIIRKRDNALELSQLENRILNQTADMLQLASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQRVPSA    141 - 210
RPVPQPPPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQ    211 - 280
ALEDGHDTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLG    281 - 350
LENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLD    351 - 420
RDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRPNPN    421 - 490
TFH                                                                       491 - 493
//

Text Mined References (58)

PMID Year Title