Property Summary

NCBI Gene PubMed Count 26
PubMed Score 17.07
PubTator Score 22.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 8.8e-27
osteosarcoma 7933 8.9e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.000 8.9e-04
psoriasis -1.200 8.8e-27

Protein-protein Interaction (1)

Gene RIF (14)

PMID Text
25977256 Ang-4 also promoted survival of LECs. Thus, blocking Ang-4 may prune the draining lymphatic vasculature and decrease interstitial fluid pressure (IFP) by reducing vascular permeability.
24760148 acute-phase protein A1AT is a physiological regulator of angptl4, another acute-phase protein.
22267746 Angptl4 is a glucocorticoid-responsive mediator of fasting-induced intracellular lipolysis and stimulates cAMP signaling in adipocytes
21603628 In tumor cells, only Ang-4 expression has prognostic impact in NSCLC. In NSCLC tumor stroma, Ang-4 and Ang-2 are independently associated with survival.
20823154 Results establish the novel effects of Ang-4 on tumor angiogenesis and GBM progression and suggest that this pro-GBM effect of Ang-4 is mediated by promoting tumor angiogenesis and activating Erk1/2 kinase in GBM cells.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20596041 Linkage to 20p13 including the ANGPT4 gene in families with mixed Alzheimer disease and vascular dementia is reported.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)
17724803 Results describe the expression of angiopoietin-1, 2 and 4 and Tie-1 and 2 in gastrointestinal stromal tumors, leiomyomas and schwannomas.
16790085 angiopoietin-4 inhibits angiogenesis and reduces interstitial fluid pressure
15284220 Recombinant Ang4 formed disulfide-linked dimers. Ang4 produces corneal angiogenesis extending from the limbus across the mouse cornea in vivo. Ang4 is an agonist of Tie2.
15198927 the angiopoietin/Tie-2 system may participate in the angiogenic response to hypoxia in renal tissues and in tumor angiogenesis in renal carcinoma.

AA Sequence

MLSQLAMLQGSLLLVVATMSVAQQTRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQR      1 - 70
ESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTILRSKLEQVQQQMAQNQTAPMLELGTSLLN     71 - 140
QTTAQIRKLTDMEAQLLNQTSRMDAQMPETFLSTNKLENQLLLQRQKLQQLQGQNSALEKRLQALETKQQ    141 - 210
EELASILSKKAKLLNTLSRQSAALTNIERGLRGVRHNSSLLQDQQHSLRQLLVLLRHLVQERANASAPAF    211 - 280
IMAGEQVFQDCAEIQRSGASASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYK    281 - 350
QGFGDPAGEHWLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQ    351 - 420
SSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIRWHYFKGPSYS    421 - 490
LRASRMMIRPLDI                                                             491 - 503
//

Text Mined References (28)

PMID Year Title
25977256 2015 Angiopoietin-4 increases permeability of blood vessels and promotes lymphatic dilation.
24760148 2014 Acute-phase protein ?1-antitrypsin--a novel regulator of angiopoietin-like protein 4 transcription and secretion.
22267746 2012 Angiopoietin-like 4 (Angptl4) protein is a physiological mediator of intracellular lipolysis in murine adipocytes.
21603628 2011 Prognostic impacts of angiopoietins in NSCLC tumor cells and stroma: VEGF-A impact is strongly associated with Ang-2.
20823154 2010 Angiopoietin-4 promotes glioblastoma progression by enhancing tumor cell viability and angiogenesis.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20596041 2010 Linkage to 20p13 including the ANGPT4 gene in families with mixed Alzheimer's disease and vascular dementia.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19234476 2009 Control of vascular morphogenesis and homeostasis through the angiopoietin-Tie system.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
17724803 2007 Expression of angiopoietin-1, 2 and 4 and Tie-1 and 2 in gastrointestinal stromal tumor, leiomyoma and schwannoma.
16790085 2006 Angiopoietin-4 inhibits angiogenesis and reduces interstitial fluid pressure.
15851516 2005 Multiple angiopoietin recombinant proteins activate the Tie1 receptor tyrosine kinase and promote its interaction with Tie2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15284220 2004 Biological characterization of angiopoietin-3 and angiopoietin-4.
15198927 2004 Expression of angiopoietins in renal epithelial and clear cell carcinoma cells: regulation by hypoxia and participation in angiogenesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12958144 2003 Hypoxia-inducible factor-1 mediates activation of cultured vascular endothelial cells by inducing multiple angiogenic factors.
12624729 2003 Identification of a novel human angiopoietin-like gene expressed mainly in heart.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11856872 2001 Genomic structures of the human angiopoietins show polymorphism in angiopoietin-2.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10343124 1999 Assignment of ANGPT4, ANGPT1, and ANGPT2 encoding angiopoietins 4, 1 and 2 to human chromosome bands 20p13, 8q22.3-->q23 and 8p23.1, respectively, by in situ hybridization and radiation hybrid mapping.
10218486 1999 Angiopoietin-3, a novel member of the angiopoietin family.
10051567 1999 Angiopoietins 3 and 4: diverging gene counterparts in mice and humans.
10025962 1999 Molecular cloning and characterization of a novel angiopoietin family protein, angiopoietin-3.