Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.15
PubTator Score 1.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer 1.300 4.7e-03
oligodendroglioma 1.100 1.8e-02
osteosarcoma -1.019 9.0e-05
pancreatic cancer -1.400 5.3e-03
primary pancreatic ductal adenocarcinoma -1.383 2.0e-03

AA Sequence

MIASCLCYLLLPATRLFRALSDAFFTCRKNVLLANSSSPQVEGDFAMAPRGPEQEECEGLLQQWREEGLS      1 - 70
QVLSTASEGPLIDKGLAQSSLALLMDNPGEENAASEDRWSSRQLSDLRAAENLDEPFPEMLGEEPLLEVE     71 - 140
GVEGSMWAAIPMQSEPQYADCAALPVGALATEQWEEDPAVLAWSIAPEPVPQEEASIWPFEGLGQLQPPA    141 - 210
VEIPYHEILWREWEDFSTQPDAQGLKAGDGPQFQFTLMSYNILAQDLMQQSSELYLHCHPDILNWNYRFV    211 - 280
NLMQEFQHWDPDILCLQEVQEDHYWEQLEPSLRMMGFTCFYKRRTGCKTDGCAVCYKPTRFRLLCASPVE    281 - 350
YFRPGLELLNRDNVGLVLLLQPLVPEGLGQVSVAPLCVANTHILYNPRRGDVKLAQMAILLAEVDKVARL    351 - 420
SDGSHCPIILCGDLNSVPDSPLYNFIRDGELQYHGMPAWKVSGQEDFSHQLYQRKLQAPLWPSSLGITDC    421 - 490
CQYVTSCHPKRSERRKYGRDFLLRFRFCSIACQRPVGLVLMEGVTDTKPERPAGWAESVLEEDASELEPA    491 - 560
FSRTVGTIQHCLHLTSVYTHFLPQRGRPEVTTMPLGLGMTVDYIFFSAESCENGNRTDHRLYRDGTLKLL    561 - 630
GRLSLLSEEILWAANGLPNPFCSSDHLCLLASFGMEVTAP                                  631 - 670
//

Text Mined References (10)

PMID Year Title